Home » NLRP1/NALP1 » NLRP1/NALP1 Antibodies » NLRP1/NALP1 Antibody
Novus Biologicals products are now on bio-techne.com

NLRP1/NALP1 Antibody

 (22 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: NLRP1/NALP1 Antibody [NBP1-54899] - NCI-H226 cell lysate, concentration 0.2-1 ug/ml.
Western Blot: NLRP1/NALP1 Antibody [NBP1-54899] - NCI-H226 cell lysate, concentration 0.2-1 ug/ml.
Western Blot: NLRP1/NALP1 Antibody [NBP1-54899] Human MCF7 whole cell. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
0.5 mg/ml

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

NLRP1/NALP1 Antibody Summary

Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptides corresponding to NLRP1(NLR family, pyrin domain containing 1) The peptide sequence was selected from the N terminal of NLRP1 (NP_001028225). DTQEPRIVILQGAAGIGKSTLARQVKEAWGRGQLYGDRFQHVFYFSCREL. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NLRP1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 1:10-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Frozen 1:10-1:500
  • Western Blot 1.0 ug/ml
Application Notes
Use in Immunocytochemistry/immunofluorescence and Immunohistochemistry-Frozen reported in scientific literature (PMID 24008734).
Publications
Read Publications using
NBP1-54899 in the following applications:

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 30342528). Cow: 85%; Dog: 86%; Guinea Pig: 85%; Horse: 85%; Pig: 86%; Rabbit: 85%.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for NLRP1/NALP1 Antibody

  • CARD7
  • CARD7SLEV1
  • Caspase recruitment domain-containing protein 7
  • CLR17.1
  • Death effector filament-forming ced-4-like apoptosis protein
  • DEFCAP
  • DEFCAPVAMAS1
  • DKFZp586O1822
  • KIAA0926DEFCAP-L/S
  • NACHT, leucine rich repeat and PYD (pyrin domain) containing 1
  • NACHT, leucine rich repeat and PYD containing 1
  • NACHT, LRR and PYD containing protein 1
  • NACHT, LRR and PYD domains-containing protein 1
  • NACPP1044
  • NALP1
  • NALP1caspase recruitment domain protein 7
  • NLR family, pyrin domain containing 1
  • NLRP1
  • Nucleotide-binding domain and caspase recruitment domain
  • nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domaincontaining 1
  • PP1044
  • SLEV1
  • VAMAS1

Background

This gene encodes a member of the Ced-4 family of apoptosis proteins. Ced-family members contain a caspase recruitment domain (CARD) and are known to be key mediators of programmed cell death. The encoded protein contains a distinct N-terminal pyrin-like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(818 Publications)
Species: Hu
Applications: BA
Catalase Antibody
[Unconjugated]
AF3398
Western Blot Catalase Antibody [Unconjugated]
Simple Western Catalase Antibody [Unconjugated]
Knockout Validated Catalase Antibody [Unconjugated]
(3 Reviews)
(15 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Caspase-3 Antibody
[Unconjugated] - Acti ...
AF835
Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active
Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active
Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active
(7 Reviews)
(389 Publications)
Species: Hu, Mu
Applications: ICC, IHC
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NFkB p105/p50
Antibody (2J10D7) - B ...
NB100-56583
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
(1 Review)
(5 Publications)
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
JNK1 Antibody
(228601) [Unconjugate
MAB17761
Western Blot JNK1 Antibody (228601) [Unconjugated]
Western Blot JNK1 Antibody (228601) [Unconjugated]
Immunocytochemistry JNK1 Antibody (228601) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC, WB
ERK1 Antibody
(1E5) - BSA Free
NBP2-22203
Flow Cytometry ERK1 Antibody (1E5) - BSA Free
Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free
Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
c-jun [p Ser63]
Antibody (1018Y) [Unc ...
MAB8930
Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
ROS Antibody
(OTI1F3)
NBP2-45626
Immunohistochemistry ROS Antibody (OTI1F3)
Immunohistochemistry ROS Antibody (OTI1F3)
Immunohistochemistry ROS Antibody (OTI1F3)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
SOD1/Cu-Zn SOD
Antibody
NBP2-24915
Western Blot SOD1/Cu-Zn SOD Antibody
Western Blot SOD1/Cu-Zn SOD Antibody
Immunohistochemistry-Paraffin SOD1/Cu-Zn SOD Antibody
(3 Reviews)
(21 Publications)
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(664 Publications)
Species: Mu
Applications: ELISA
PARP Antibody
(194C1439) - Cleaved ...
NBP2-27335
Immunocytochemistry/ Immunofluorescence PARP Antibody (194C1439) - Cleaved - Azide and BSA Free
Western Blot PARP Antibody (194C1439) - Cleaved - Azide and BSA Free
Western Blot PARP Antibody (194C1439) - Cleaved - Azide and BSA Free
(1 Review)
(9 Publications)
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, WB
Bcl-2 Antibody
NB100-56098
Western Blot Bcl-2 Antibody
Western Blot Bcl-2 Antibody
Western Blot Bcl-2 Antibody
(2 Reviews)
(26 Publications)
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Cytochrome c
Antibody (7H8.2C12) - ...
NB100-56503
Flow Cytometry Cytochrome c Antibody (7H8.2C12) - BSA Free
Flow (Intracellular) Cytochrome c Antibody (7H8.2C12) - BSA Free
Western Blot Cytochrome c Antibody (7H8.2C12) - BSA Free
(61 Publications)
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
iNOS Antibody -
BSA Free
NB300-605
Western Blot iNOS Antibody - BSA Free
Western Blot iNOS Antibody - BSA Free
Western Blot iNOS Antibody - BSA Free
(3 Reviews)
(130 Publications)
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
EphB2 Antibody
[Unconjugated]
AF467
Simple Western EphB2 Antibody [Unconjugated]
Western Blot EphB2 Antibody [Unconjugated]
Immunocytochemistry EphB2 Antibody [Unconjugated]
(5 Reviews)
(62 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Bax Antibody (6A7)
NBP1-28566
Western Blot Bax Antibody (6A7)
Western Blot Bax Antibody (6A7)
Immunohistochemistry-Frozen Bax Antibody (6A7)
(3 Reviews)
(21 Publications)
Species: Bv, Hu, Pm, Mu, Po, Rt
Applications: Func, IHC, IHC-Fr, IHC-P, WB
NLRP3/NALP3
Antibody - BSA Free
NBP2-12446
Western Blot NLRP3/NALP3 Antibody - BSA Free
Western Blot NLRP3/NALP3 Antibody - BSA Free
Western Blot NLRP3/NALP3 Antibody - BSA Free
(4 Reviews)
(234 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IP, KD, WB

Myeloperoxidase/MPO An ...
AF3667
Western Blot Myeloperoxidase/MPO Antibody [Unconjugated]
Simple Western Myeloperoxidase/MPO Antibody [Unconjugated]
Immunocytochemistry Myeloperoxidase/MPO Antibody [Unconjugated]
(3 Reviews)
(167 Publications)
Species: Hu, Mu
Applications: Dual ISH-IHC, ICC, IHC, Simple Western, WB
NLRP1/NALP1
Antibody
NBP1-54899
NLRP1/NALP1 Antibody
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC

Publications for NLRP1/NALP1 Antibody (NBP1-54899)(22)

We have publications tested in 3 confirmed species: Human, Mouse, Rat.

We have publications tested in 5 applications: ICC/IF, IF/IHC, IHC-Fr, Immunohistochemistry, WB.


Filter By Application
ICC/IF
(2)
IF/IHC
(3)
IHC-Fr
(1)
Immunohistochemistry
(1)
WB
(9)
All Applications
Filter By Species
Human
(2)
Mouse
(8)
Rat
(1)
All Species
Showing Publications 1 - 10 of 22. Show All 22 Publications.
Publications using NBP1-54899 Applications Species
Inés Muela-Zarzuela, Juan Miguel Suarez-Rivero, Andrea Gallardo-Orihuela, Chun Wang, Kumi Izawa, Marta de Gregorio-Procopio, Isabelle Couillin, Bernhard Ryffel, Jiro Kitaura, Alberto Sanz, Thomas von Zglinicki, Gabriel Mbalaviele, Mario D Cordero NLRP1 inflammasome promotes senescence and senescence-associated secretory phenotype. Inflammation research : official journal of the European Histamine Research Society ... [et al.] 2024-06-21 [PMID: 38907167]
Xiaofan Yu, Gabrielle Benitez, Peter Tszki Wei, Sofia V. Krylova, Ziyi Song, Li Liu, Meifan Zhang, Alus M. Xiaoli, Henna Wei, Fenfen Chen, Simone Sidoli, Fajun Yang, Kosaku Shinoda, Jeffrey E. Pessin, Daorong Feng Involution of brown adipose tissue through a Syntaxin 4 dependent pyroptosis pathway Nature Communications 2024-04-02 [PMID: 38565851]
Muela-Zarzuela IS, Suarez-Rivero JM, Gallardo-Orihuela A et al. NLRP1 inflammasome modulates senescence and senescence-associated secretory phenotype bioRxiv : the preprint server for biology 2023-02-10 [PMID: 36798300] (WB, Human) WB Human
Li Y, Li Z, He F et al. Electroacupuncture alleviates cognitive dysfunction and neuronal pyroptosis in septic mice Acupuncture in medicine : journal of the British Medical Acupuncture Society 2022-10-18 [PMID: 36255337]
Chen SH, Scott XO, Ferrer Marcelo Y et al. Netosis and Inflammasomes in Large Vessel Occlusion Thrombi Frontiers in Pharmacology 2021-01-22 [PMID: 33569001] (Immunohistochemistry) Immunohistochemistry
Franke M, Bieber M, Kraft P et al. The NLRP3 inflammasome drives inflammation in ischemia/reperfusion injury after transient middle cerebral artery occlusion in mice Brain, behavior, and immunity 2020-12-09 [PMID: 33307174] (WB, Mouse) WB Mouse
Logan S Roles of Inflammatory Signaling and MicroRNA in the Adipose Stress Response of Hibernating Ictidomys Tridecemlineatus Thesis 2021-11-26
PErez-SisquEs L, Solana-Balaguer J, Campoy-Campos G Et al. RTP801/REDD1 is Involved in Neuroinflammation and Modulates Cognitive Dysfunction in Huntington’s Disease preprint Nov 26 2021 (WB, Mouse) WB Mouse
P�rez-Sisqu�s L, Solana-Balaguer J, Campoy-Campos G et al. RTP801/REDD1 Is Involved in Neuroinflammation and Modulates Cognitive Dysfunction in Huntington's Disease Biomolecules 2021-12-27 [PMID: 35053183]
PErez-SisquEs L, Sancho-Balsells A, Solana-Balaguer J et al. RTP801/REDD1 contributes to neuroinflammation severity and memory impairments in Alzheimer’s disease Cell Death & Disease 2021-06-01 [PMID: 34131105] (WB) WB
Show All 22 Publications.

Reviews for NLRP1/NALP1 Antibody (NBP1-54899) (0)

There are no reviews for NLRP1/NALP1 Antibody (NBP1-54899). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NLRP1/NALP1 Antibody (NBP1-54899) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NLRP1/NALP1 Products

Research Areas for NLRP1/NALP1 Antibody (NBP1-54899)

Find related products by research area.

Blogs on NLRP1/NALP1.

Check out the latest blog posts on NLRP1/NALP1.
Pyroptosis: Mechanisms mediating cell death and pro-inflammatory cytokine release
By Victoria OsinskiPyroptosis is an inflammatory form of programmed cell death characterized by the release of pro-inflammatory cytokines IL-1 beta and IL-18.1,10 It is a process distinct from apoptosis and necrosis (T...  Read full blog post.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NLRP1/NALP1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol NLRP1
Entrez
Uniprot