![Western Blot: NKIRAS1 Antibody [NBP2-93958] - Analysis of extracts of various cell lines, using NKIRAS1 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 30s.](http://images.novusbio.com/fullsize/NKIRAS1-Antibody-Western-Blot-NBP2-93958-img0001.jpg "Western Blot: NKIRAS1 Antibody [NBP2-93958] - Analysis of extracts of various cell lines, using NKIRAS1 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 30s.")
| Reactivity | Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 118-192 of human NKIRAS1 (NP_065078.1). LGNKIDLSEQRQVDAEVAQQWAKSEKVRLWEVTVTDRKTLIEPFTLLASKLSQPQSKSSFPLPGRKNKGNSNSEN |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NKIRAS1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 21 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.01% Thimerosal |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for NKIRAS1 Antibody (NBP2-93958)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | NKIRAS1 |
![Immunocytochemistry/Immunofluorescence: NKIRAS1 Antibody [NBP2-93958] - Immunofluorescence analysis of PC-12 cells using NKIRAS1 Rabbit pAb (NBP2-93958) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/NKIRAS1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-93958-img0003.jpg "Immunocytochemistry/Immunofluorescence: NKIRAS1 Antibody [NBP2-93958] - Immunofluorescence analysis of PC-12 cells using NKIRAS1 Rabbit pAb (NBP2-93958) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunocytochemistry/Immunofluorescence: NKIRAS1 Antibody [NBP2-93958] - Immunofluorescence analysis of NIH/3T3 cells using NKIRAS1 Rabbit pAb (NBP2-93958) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/NKIRAS1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-93958-img0002.jpg "Immunocytochemistry/Immunofluorescence: NKIRAS1 Antibody [NBP2-93958] - Immunofluorescence analysis of NIH/3T3 cells using NKIRAS1 Rabbit pAb (NBP2-93958) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Immunohistochemistry Integrin alpha 9 Antibody [Unconjugated]](https://images.novusbio.com/images2/Integrin_alpha_9_AF3827_Immunohistochemistry_24134.jpg)
![Immunocytochemistry/ Immunofluorescence Integrin alpha 9 Antibody [Unconjugated]](https://images.novusbio.com/images/af3827_mouse-integrin-alpha-9-affinity-purified-polyclonal-ab-41202412394961.jpg)
![Immunocytochemistry/ Immunofluorescence Integrin alpha 9 Antibody [Unconjugated]](https://images.novusbio.com/images/af3827_mouse-integrin-alpha-9-affinity-purified-polyclonal-ab-41202412402515.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")