![Immunocytochemistry/Immunofluorescence: Ninein Antibody [NBP2-13657] - Staining of human cell line U-251 MG shows localization to nucleoli and centrosome.](http://images.novusbio.com/fullsize/Ninein-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13657-img0009.jpg "Immunocytochemistry/Immunofluorescence: Ninein Antibody [NBP2-13657] - Staining of human cell line U-251 MG shows localization to nucleoli and centrosome.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: EERLTQMRNEYERQCRVLQDQVDELQSELEEYRAQGRVLRLPLKNSPSEEVEANSGGIEPEHGLGSEECNPLNMSIEAELVIEQMKEQHHRDICCLRLELEDKVRHYEKQLDETVVSCKKAQENMKQRHENETHTL |
| Marker | Centrosome Marker |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NIN |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP2-13657 | Applications | Species |
|---|---|---|
| Thirugnanam K, Gupta A, Nunez F et al. Brain microvascular endothelial cells possess a second cilium that arises from the daughter centriole Frontiers in molecular biosciences 2023-11-06 [PMID: 38028541] (ICC/IF, Mouse) | ICC/IF | Mouse |
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
reviewed by:
KARTHIKEYAN THIRUGNANAM |
ICC | Human | 10/21/2021 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for Ninein Antibody (NBP2-13657)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | NIN |
![Immunohistochemistry-Paraffin: Ninein Antibody [NBP2-13657] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.](http://images.novusbio.com/fullsize/Ninein-Antibody-Immunohistochemistry-Paraffin-NBP2-13657-img0013.jpg "Immunohistochemistry-Paraffin: Ninein Antibody [NBP2-13657] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.")
![Immunohistochemistry-Paraffin: Ninein Antibody [NBP2-13657] - Staining of human tonsil shows moderate cytoplasmic and membranous positivity in germinal center cells.](http://images.novusbio.com/fullsize/Ninein-Antibody-Immunohistochemistry-Paraffin-NBP2-13657-img0010.jpg "Immunohistochemistry-Paraffin: Ninein Antibody [NBP2-13657] - Staining of human tonsil shows moderate cytoplasmic and membranous positivity in germinal center cells.")
![Immunohistochemistry-Paraffin: Ninein Antibody [NBP2-13657] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/Ninein-Antibody-Immunohistochemistry-Paraffin-NBP2-13657-img0011.jpg "Immunohistochemistry-Paraffin: Ninein Antibody [NBP2-13657] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: Ninein Antibody [NBP2-13657] - Staining of human stomach shows moderate cytoplasmic positivity in parietal cells.](http://images.novusbio.com/fullsize/Ninein-Antibody-Immunohistochemistry-Paraffin-NBP2-13657-img0012.jpg "Immunohistochemistry-Paraffin: Ninein Antibody [NBP2-13657] - Staining of human stomach shows moderate cytoplasmic positivity in parietal cells.")
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_6532.jpg)
![Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase3_AF835_Immunohistochemistry_22976.jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_9340.jpg)
![N/A Leptin/OB [HRP]](https://images.novusbio.com/images2/Leptin_DLP00_ELISA_134.jpg)
![N/A Leptin/OB [HRP]](https://images.novusbio.com/images2/DATA_Leptin_DLP00_ELISA_749.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
