Home » NGDN » NGDN Proteins » NGDN Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

NGDN Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for NGDN Protein (NBP1-88408PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

NGDN Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NGDN.

Source: E. coli

Amino Acid Sequence: LMYLMDLTHLILDKASGGSLQGHDAVLRLVEIRTVLEKLRPLDQKLKYQIDKLIKTAVTGSLSENDPLRFKPHPSNMMSKLSSEDEEEDEAEDDQSEASGKKSVKGVSKKYVPPRLVPVHYDETEAEREKKRLERAKRRALSSSVIREL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NGDN
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88408.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NGDN Recombinant Protein Antigen

  • C14orf120
  • DKFZP564O092
  • EIF4E-binding protein
  • eukaryotic initiation factor 4E and CPEB binding protein
  • LCP5
  • lpd-2
  • neuroguidin
  • neuroguidin, EIF4E binding protein
  • NGDchromosome 14 open reading frame 120

Background

Neuroguidin is an EIF4E (MIM 133440)-binding protein that interacts with CPEB (MIM 607342) and functions as a translational regulatory protein during development of the vertebrate nervous system (Jung et al., 2006 [PubMed 16705177]).[supplied by OMIM].

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

eIF4E [p Ser209]
Antibody
NB100-81898
Western Blot eIF4E [p Ser209] Antibody
Immunocytochemistry/ Immunofluorescence eIF4E [p Ser209] Antibody
Immunohistochemistry-Paraffin eIF4E [p Ser209] Antibody
(1 Publication)
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, WB
4EBP1 Antibody
NB200-157
Knockout Validated 4EBP1 Antibody
Western Blot 4EBP1 Antibody
Western Blot 4EBP1 Antibody
(45 Publications)
Species: Hu
Applications: IHC, IHC-P, KO, WB
eIF4G1 Antibody
NB100-268
Western Blot eIF4G1 Antibody
Immunoprecipitation eIF4G1 Antibody
(26 Publications)
Species: Hu, Po
Applications: IP, WB
Ribosomal Protein
S6/RPS6 Antibody
NB100-1595
Immunohistochemistry-Paraffin Ribosomal Protein S6/RPS6 Antibody
Western Blot Ribosomal Protein S6/RPS6 Antibody
Immunoprecipitation Ribosomal Protein S6/RPS6 Antibody
(1 Review)
(6 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
TOR/mTOR [p
Ser2448] Antibody
NB600-607
Immunohistochemistry-Paraffin TOR/mTOR [p Ser2448] Antibody
Western Blot TOR/mTOR [p Ser2448] Antibody
Data TOR/mTOR [p Ser2448] Antibody
(2 Reviews)
(9 Publications)
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
Tbp7 Antibody
NBP1-87799
Immunohistochemistry-Paraffin Tbp7 Antibody
Western Blot Tbp7 Antibody
Western Blot Tbp7 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(49 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
CPEB1 Antibody
NB100-1437
Western Blot CPEB1 Antibody
(3 Publications)
Species: Hu
Applications: PEP-ELISA, WB
eIF4A2 Antibody
NBP2-24529
Western Blot eIF4A2 Antibody
Immunohistochemistry-Paraffin eIF4A2 Antibody
Simple Western eIF4A2 Antibody
(1 Review)
(1 Publication)
Species: Ca, Ch, Hu, Mu, Pm
Applications: IHC, IHC-P, Simple Western, WB
EIF2 beta Antibody
(2F3)
H00008894-M09
Immunocytochemistry/ Immunofluorescence EIF2 beta Antibody (2F3)
Immunohistochemistry-Paraffin EIF2 beta Antibody (2F3)
Western Blot EIF2 beta Antibody (2F3)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
HBS1L Antibody
NBP1-85123
Knockdown Validated HBS1L Antibody
Immunocytochemistry/ Immunofluorescence HBS1L Antibody
(2 Publications)
Species: Hu
Applications: ICC/IF, KD, WB
ZFP36L1 Antibody
NBP2-86906
Immunohistochemistry-Paraffin ZFP36L1 Antibody
Immunohistochemistry-Paraffin ZFP36L1 Antibody
Immunohistochemistry-Paraffin ZFP36L1 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
eRF1 Antibody
NBP1-31113
Immunohistochemistry-Paraffin eRF1 Antibody
Immunohistochemistry-Paraffin eRF1 Antibody
Immunocytochemistry/ Immunofluorescence eRF1 Antibody
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
EIF2B2 Antibody
NBP1-84877
Immunohistochemistry-Paraffin EIF2B2 Antibody
Immunohistochemistry-Paraffin EIF2B2 Antibody
Immunohistochemistry-Paraffin EIF2B2 Antibody
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
eIF2B4 Antibody
NBP3-24813
Western Blot eIF2B4 Antibody
Immunocytochemistry/ Immunofluorescence eIF2B4 Antibody
Immunohistochemistry-Paraffin eIF2B4 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
eIF4ENIF1 Antibody
H00056478-B01P
Immunocytochemistry/ Immunofluorescence eIF4ENIF1 Antibody
Western Blot eIF4ENIF1 Antibody
Western Blot eIF4ENIF1 Antibody
(3 Publications)
Species: Hu, Mu
Applications: Dual ISH-IHC, ICC/IF, IP, WB
AP-2 gamma
Antibody [Unconjugate
AF5059
Western Blot AP-2 gamma Antibody [Unconjugated]
Immunohistochemistry AP-2 gamma Antibody [Unconjugated]
(11 Publications)
Species: Hu
Applications: IHC, WB
Annexin A6 Antibody
NBP1-90149
Western Blot Annexin A6 Antibody
Immunohistochemistry-Paraffin Annexin A6 Antibody
Immunohistochemistry-Paraffin Annexin A6 Antibody
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NGDN Recombinant
Protein Antigen
NBP1-88408PEP
NGDN Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for NGDN Protein (NBP1-88408PEP) (0)

There are no publications for NGDN Protein (NBP1-88408PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NGDN Protein (NBP1-88408PEP) (0)

There are no reviews for NGDN Protein (NBP1-88408PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NGDN Protein (NBP1-88408PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NGDN Products

Blogs on NGDN

There are no specific blogs for NGDN, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NGDN Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol NGDN