![Western Blot: NF2/Merlin Antibody [NBP3-03740] - Analysis of extracts of various cell lines, using NF2/Merlin antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.](http://images.novusbio.com/fullsize/NF2-Merlin-Antibody-Western-Blot-NBP3-03740-img0002.jpg "Western Blot: NF2/Merlin Antibody [NBP3-03740] - Analysis of extracts of various cell lines, using NF2/Merlin antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IP, KO |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 477-576 of human NF2/Merlin (NP_000259.1). TKPTYPPMNPIPAPLPPDIPSFNLIGDSLSFDFKDTDMKRLSMEIEKEKVEYMEKSKHLQEQLNELKTEIEALKLKERETALDILHNENSDRGGSSKHNT |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NF2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS with 50% glycerol, pH7.3. |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
![Flow Cytometry ERMAP Antibody [Unconjugated]](https://images.novusbio.com/images2/ERMAP_AF4928_Flow_Cytometry_11957.jpg)
![Immunohistochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunohistochemistry_20892.jpg)
![Immunocytochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunocytochemistry__Immunofluorescence_21143.jpg)
![Western Blot EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Western_Blot_19925.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for NF2/Merlin Antibody (NBP3-03740)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | NF2 |
![Immunocytochemistry/Immunofluorescence: NF2/Merlin Antibody [NBP3-03740] - Immunofluorescence analysis of U2OS cells using NF2/Merlin antibody (NBP3-03740) at dilution of 1:100. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/NF2-Merlin-Antibody-Immunocytochemistry-Immunofluorescence-NBP3-03740-img0006.jpg "Immunocytochemistry/Immunofluorescence: NF2/Merlin Antibody [NBP3-03740] - Immunofluorescence analysis of U2OS cells using NF2/Merlin antibody (NBP3-03740) at dilution of 1:100. Blue: DAPI for nuclear staining.")
![Immunocytochemistry/Immunofluorescence: NF2/Merlin Antibody [NBP3-03740] - Immunofluorescence analysis of C6 cells using NF2/Merlin antibody (NBP3-03740) at dilution of 1:100. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/NF2-Merlin-Antibody-Immunocytochemistry-Immunofluorescence-NBP3-03740-img0004.jpg "Immunocytochemistry/Immunofluorescence: NF2/Merlin Antibody [NBP3-03740] - Immunofluorescence analysis of C6 cells using NF2/Merlin antibody (NBP3-03740) at dilution of 1:100. Blue: DAPI for nuclear staining.")
![Immunocytochemistry/Immunofluorescence: NF2/Merlin Antibody [NBP3-03740] - Immunofluorescence analysis of L929 cells using NF2/Merlin antibody (NBP3-03740) at dilution of 1:100. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/NF2-Merlin-Antibody-Immunocytochemistry-Immunofluorescence-NBP3-03740-img0005.jpg "Immunocytochemistry/Immunofluorescence: NF2/Merlin Antibody [NBP3-03740] - Immunofluorescence analysis of L929 cells using NF2/Merlin antibody (NBP3-03740) at dilution of 1:100. Blue: DAPI for nuclear staining.")
![Knockout Validated: NF2/Merlin Antibody [NBP3-03740] - Analysis of extracts from normal (control) and NF2 knockout (KO) HeLa cells, using NF2/Merlin antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.](http://images.novusbio.com/fullsize/NF2-Merlin-Antibody-Knockout-Validated-NBP3-03740-img0001.jpg "Knockout Validated: NF2/Merlin Antibody [NBP3-03740] - Analysis of extracts from normal (control) and NF2 knockout (KO) HeLa cells, using NF2/Merlin antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.")
![Immunoprecipitation: NF2/Merlin Antibody [NBP3-03740] - Immunoprecipitation analysis of 200ug extracts of SKOV3 cells using 3ug NF2/Merlin antibody (NBP3-03740). Western blot was performed from the immunoprecipitate using NF2/Merlin antibody (NBP3-03740) at a dilution of 1:1000.](http://images.novusbio.com/fullsize/NF2-Merlin-Antibody-Immunoprecipitation-NBP3-03740-img0003.jpg "Immunoprecipitation: NF2/Merlin Antibody [NBP3-03740] - Immunoprecipitation analysis of 200ug extracts of SKOV3 cells using 3ug NF2/Merlin antibody (NBP3-03740). Western blot was performed from the immunoprecipitate using NF2/Merlin antibody (NBP3-03740) at a dilution of 1:1000.")
![Immunohistochemistry Neprilysin/CD10 Antibody [Unconjugated]](https://images.novusbio.com/images2/Neprilysin_AF1126_Immunohistochemistry_6679.jpg)
![Western Blot Neprilysin/CD10 Antibody [Unconjugated]](https://images.novusbio.com/images/af1126_mouse-neprilysin-affinity-purified-polyclonal-ab-8220249505976.jpg)
![Western Blot Neprilysin/CD10 Antibody [Unconjugated]](https://images.novusbio.com/images/af1126_mouse-neprilysin-affinity-purified-polyclonal-ab-44202415433122.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")