Novus Biologicals products are now on bio-techne.com

Recombinant Human Neuropeptide Y GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human Neuropeptide Y Protein [H00004852-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Recombinant Human Neuropeptide Y GST (N-Term) Protein Summary

Description
Recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-97 of Human NPY

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MLGNKRLGLSGLTLALSLLVCLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSPETLISDLLMRESTENVPRTRLEDPAMW

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
NPY
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.41 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Neuropeptide Y GST (N-Term) Protein

  • 170 kDa melanoma membrane-bound gelatinase
  • DKFZp686G13158
  • DPPIV
  • EC 3.4.21.-
  • FAPA
  • Fibroblast activation protein alpha
  • fibroblast activation protein, alpha
  • Integral membrane serine protease
  • Neuropeptide Y
  • NPY
  • PYY4
  • seprase

Background

NPY a 36 amino acid peptide amide isolated from porcine brain, is a major regulatory neuropeptide in the mammalian central and peripheral nervous systems. NPY belongs to the pancreatic polypeptide family of peptides which are characterized by a common tertiary structure. Within this family, an intestinal peptide hormone, peptide YY (PYY), is most closely related to NPY. In the central nervous system (CNS) NPY is considered to be involved in regulation of blood pressure, memory processing, circadian rhythm, and stimulation of food intake. In the peripheral nervous system (PNS), NPY evokes potent vasoconstrictor activity and acts as a transmitter/neuromodulator of sympathetic neurons and adrenal glands. NPY is one of the most abundant peptides found in the CNS. NPY and NPY mRNA are widely distributed in the brain. High levels of NPY are present in the cerebral cortex, amygdaloid nuclei, hippocampal formation, and hypothalamus. In the PNS, NPY is widely distributed in sympathetic neurons that innervate vascular smooth muscle, heart, and urogenital tract. In these neurons NPY is mainly co-localized with norepinephrine and is considered to function as a neurotransmitter to presynaptically inhibit nor adrenergic neurotransmission. The biological actions of NPY in the brain and periphery are mediated by at least two different NPY receptors, designated Y1 and Y2 receptor subtypes. Cardiovascular effects and centrally evoked food intake potential are activities predominantly mediated by the Y1 receptors, whereas the Y2 receptors, the major subtype in the CNS, are mainly involved in the pre-synaptic inhibition of neurotransmitter release and facilitation of memory retention. Post-synaptic NPY receptors are apparently of both the Y1 and Y2 type. NPY receptors are coupled to at least two different signal transduction mechanisms, the adenylate cyclase pathway (decrease in cAMP), and the phosphoinositol/IP3 pathway. Antibodies that react specifically with NPY are useful for the study of the mode of action, differential tissue expression, and intracellular and subcellular localization of NPY in the central and peripheral nervous systems.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP2-46349
Species: Hu
Applications: IHC, WB
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NBP1-80865
Species: Hu
Applications: IHC, IHC-P
DLP00
Species: Hu
Applications: ELISA
NBP2-37447
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
NBP2-93797
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB120-14817
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
AF1052
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
NB100-1793
Species: Hu, Pm, Mu, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
MAB4077
Species: Hu
Applications: IHC, WB
NBP2-62664
Species: Hu
Applications: IHC, IHC-P
NBP2-33582
Species: Hu, Pm
Applications: ICC/IF, IHC, IHC-P
H00001392-M02
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
DAGR00
Species: Hu
Applications: ELISA
NBP2-33903
Species: Hu
Applications: IHC, IHC-P
H00005696-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
H00004852-P01
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for Neuropeptide Y Recombinant Protein (H00004852-P01) (0)

There are no publications for Neuropeptide Y Recombinant Protein (H00004852-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Neuropeptide Y Recombinant Protein (H00004852-P01) (0)

There are no reviews for Neuropeptide Y Recombinant Protein (H00004852-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Neuropeptide Y Recombinant Protein (H00004852-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Neuropeptide Y Products

Research Areas for Neuropeptide Y Recombinant Protein (H00004852-P01)

Find related products by research area.

Blogs on Neuropeptide Y

There are no specific blogs for Neuropeptide Y, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Neuropeptide Y GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NPY