![Immunocytochemistry/Immunofluorescence: Galanin Antibody [NBP2-33582] - Staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Galanin-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-33582-img0011.jpg "Immunocytochemistry/Immunofluorescence: Galanin Antibody [NBP2-33582] - Staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.")
| Reactivity | Hu, PmSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GPHAVGNHRSFSDKNGLTSKRELRPEDDMKPGSFDRSIPENNIMRTIIEFLSFLHLKEAGALDRLLDLPAAASSEDIERS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | GAL |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry EN-RAGE/S100A12 Antibody [Unconjugated]](https://images.novusbio.com/images2/EN-RAGE_AF1052_Immunohistochemistry_6671.jpg)
![Western Blot EN-RAGE/S100A12 Antibody [Unconjugated]](https://images.novusbio.com/images2/ENRAGE_AF1052_Western_Blot_19098.jpg)
![Simple Western EN-RAGE/S100A12 Antibody [Unconjugated]](https://images.novusbio.com/images2/af1052_human-en-rage-affinity-purified-polyclonal-ab-simple-western-2672021152820.jpg)
| Images | Ratings | Applications | Species | Date | Details | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Verified Customer |
IHC-P | Macaca mulatta | 02/13/2017 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
Research Areas for Galanin Antibody (NBP2-33582)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
| Verified Customer 02/13/2017 |
||
| Application: | IHC-P | |
| Species: | Macaca mulatta |
![Immunohistochemistry-Paraffin: Galanin Antibody [NBP2-33582] - Staining of human rectum shows moderate cytoplasmic positivity in peripheral nerve / ganglion.](http://images.novusbio.com/fullsize/Galanin-Antibody-Immunohistochemistry-Paraffin-NBP2-33582-img0015.jpg "Immunohistochemistry-Paraffin: Galanin Antibody [NBP2-33582] - Staining of human rectum shows moderate cytoplasmic positivity in peripheral nerve / ganglion.")
![Immunohistochemistry-Paraffin: Galanin Antibody [NBP2-33582] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/Galanin-Antibody-Immunohistochemistry-Paraffin-NBP2-33582-img0012.jpg "Immunohistochemistry-Paraffin: Galanin Antibody [NBP2-33582] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: Galanin Antibody [NBP2-33582] - Staining of human pituitary gland shows moderate to strong cytoplasmic positivity in endocrine glandular cells.](http://images.novusbio.com/fullsize/Galanin-Antibody-Immunohistochemistry-Paraffin-NBP2-33582-img0013.jpg "Immunohistochemistry-Paraffin: Galanin Antibody [NBP2-33582] - Staining of human pituitary gland shows moderate to strong cytoplasmic positivity in endocrine glandular cells.")
![Immunohistochemistry-Paraffin: Galanin Antibody [NBP2-33582] - Staining of human placenta shows no positivity in trophoblastic cells as expected.](http://images.novusbio.com/fullsize/Galanin-Antibody-Immunohistochemistry-Paraffin-NBP2-33582-img0014.jpg "Immunohistochemistry-Paraffin: Galanin Antibody [NBP2-33582] - Staining of human placenta shows no positivity in trophoblastic cells as expected.")
![Immunohistochemistry Galectin-4 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af2128_mouse-galectin-4-affinity-purified-polyclonal-ab-immunohistochemistry-29122022154254.jpg)
![Immunohistochemistry TFF2 Antibody (366508) [Unconjugated]](https://images.novusbio.com/images2/TFF2_MAB4077_Immunohistochemistry_21485.jpg)
![Western Blot Galectin-10 Antibody [Unconjugated]](https://images.novusbio.com/images2/Galectin-10_AF5447_Western_Blot_5721.jpg)
![Intracellular Staining by Flow Cytometry Galectin-10 Antibody [Unconjugated]](https://images.novusbio.com/images2/Galectin-10_AF5447_Flow_Cytometry_8273.jpg)
![Intracellular Staining by Flow Cytometry Galectin-10 Antibody [Unconjugated]](https://images.novusbio.com/images2/af5447_human-galectin-10-affinity-purified-polyclonal-ab-flow-cytometry-2162021133613.jpg)
![Western Blot Galectin-3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Galectin3_AF1197_Western_Blot_21471.jpg)
![Immunohistochemistry Galectin-3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Galectin-3_AF1197_Immunohistochemistry_7115.jpg)
![Simple Western Galectin-3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Galectin3_AF1197_Simple_Western_18971.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
