Reactivity | HuSpecies Glossary |
Applications | IHC |
Clone | 904032 |
Clonality | Monoclonal |
Host | Mouse |
Conjugate | Unconjugated |
Immunogen | Neuropeptide Y/NPY conjugated to KLH YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY Accession # P01303 |
Specificity | Detects human Neuropeptide Y/NPY in direct ELISAs. |
Source | N/A |
Isotype | IgG2a |
Clonality | Monoclonal |
Host | Mouse |
Gene | NPY |
Purity Statement | Protein A or G purified from hybridoma culture supernatant |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
|
Publications |
|
Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles.
|
Buffer | Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied either lyophilized or as a 0.2 µm filtered solution in PBS. |
Preservative | No Preservative |
Reconstitution Instructions | Reconstitute at 0.5 mg/mL in sterile PBS. |
Neuropeptide Y (NPY) is a 36 amino acid peptide that was isolated from hypothalamus in porcine brain in 1982 and lately it belongs to a family of peptides which include Pancreatic Polypeptide (PP) and Peptide YY (PYY) which exert their pharmacological action via interaction with G-protein coupled receptors Y1, Y2, Y4, Y5 and y6. NPY is the most abundant peptide in brain and in nervous system NPY functions as a neurotransmitter regulating many processes including memory and learning, pain, fat storage and blood pressure. NPY also regulates stress by stimulating secretion of corticotropin-releasing hormone in brain. It appears there is a correlation between the increased levels of NPY gene expression in hippocampus and epileptic seizures. Cocaine reduces the levels of NPY and such a decrease is thought to be related to depression and anxiety. NPY receptors are rhodopsin-like G-protein coupled receptors (GPCR) coupled to Gi or G0 proteins, which inhibit adenylate cyclase and reduce cAMP accumulation and modulate Calcium and Potassium channels.
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.