Home » MYCBP2 » MYCBP2 Proteins » MYCBP2 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

MYCBP2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for MYCBP2 Recombinant Protein Antigen (NBP2-68745PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

MYCBP2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MYCBP2.

Source: E. coli

Amino Acid Sequence: CYHPAKPFQSQLPSVKEGISEDLPVKMPCLYLQTLARHHHENFVGYQDDNLFQDEMRYLRSTSVPAPYISVTPDASPNVFEEPESNMKSMPPSL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MYCBP2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-68745.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MYCBP2 Recombinant Protein Antigen

  • DKFZp686M08244
  • EC 6.3.2.-
  • FLJ10106
  • FLJ21646
  • KIAA0916FLJ13826
  • MYC binding protein 2
  • Myc-binding protein 2
  • Pam/highwire/rpm-1 protein
  • PAMFLJ21597
  • probable E3 ubiquitin-protein ligase MYCBP2
  • Protein associated with Myc

Background

In addition to its possible functions as a facilitator of Myc activated transcription, PAM (protein associated with Myc) has also been shown to play a role in mTOR signaling. PAM functions as an E3 ubiquitin ligase for tuberin (TSC2), a negative regulator of the mTOR pathway. Additionally PAM has been shown to function as a guanosine exchange factor (GEF) for Rheb and to facilitate sphingosine-1-phosphate signaling in the mTOR pathway. Alternative names for PAM include Myc-binding protein 2, MYCBP2, Pam/highwire/rpm-1 protein, and KIAA0916.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

TLR2 Antibody
(TL2.1) - BSA Free
NB100-56722
Flow (Cell Surface) TLR2 Antibody (TL2.1) - BSA Free
Flow Cytometry TLR2 Antibody (TL2.1) - BSA Free
Block/ Neutralize TLR2 Antibody (TL2.1) - BSA Free
(64 Publications)
Species: Ca, Hu, Mu, Rb, Rt
Applications: B/N, DB, ELISA, Flow-CS, Flow, Func, ICC/IF, IP, In vitro, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(809 Publications)
Species: Hu
Applications: BA
TLR4 Antibody
(76B357.1) - BSA Free
NB100-56566
Dual RNAscope ISH-IHC TLR4 Antibody (76B357.1) - BSA Free
Immunohistochemistry TLR4 Antibody (76B357.1) - BSA Free
Immunohistochemistry TLR4 Antibody (76B357.1) - BSA Free
(5 Reviews)
(140 Publications)
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, WB
CSK Antibody
NBP1-85951
Immunocytochemistry/ Immunofluorescence CSK Antibody
Western Blot CSK Antibody
Western Blot CSK Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(643 Publications)
Species: Mu
Applications: ELISA
TLR1 Antibody
NB100-56563
Flow Cytometry TLR1 Antibody
Flow Cytometry TLR1 Antibody
Western Blot TLR1 Antibody
(13 Publications)
Species: Hu, Mu, Rt
Applications: DB, Flow-CS, Flow-IC, Flow, IHC, IHC-P, WB
POMC Antibody
NB100-1533
Flow Cytometry POMC Antibody
Immunohistochemistry POMC Antibody
Immunohistochemistry POMC Antibody
(10 Publications)
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
IL-10 [Biotin]
DY417
N/A IL-10 [Biotin]
(297 Publications)
Species: Mu
Applications: ELISA
Glutaminyl-peptide
Cyclotransferase/QPCT ...
NBP1-81838
Western Blot Glutaminyl-peptide Cyclotransferase/QPCT Antibody
Immunohistochemistry Glutaminyl-peptide Cyclotransferase/QPCT Antibody
Immunohistochemistry-Paraffin Glutaminyl-peptide Cyclotransferase/QPCT Antibody
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
CXCL8/IL-8
Antibody (6217) [Unco ...
MAB208
Neutralization CXCL8/IL-8 Antibody (6217) [Unconjugated]
Immunocytochemistry CXCL8/IL-8 Antibody (6217) [Unconjugated]
Western Blot CXCL8/IL-8 Antibody (6217) [Unconjugated]
(1 Review)
(182 Publications)
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
NFkB p105/p50
Antibody (2J10D7) - B ...
NB100-56583
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
(1 Review)
(5 Publications)
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
Carboxypeptidase
E/CPE Antibody [Uncon ...
AF3587
Intracellular Staining by Flow Cytometry Carboxypeptidase E/CPE Antibody [Unconjugated]
Immunocytochemistry Carboxypeptidase E/CPE Antibody [Unconjugated]
Immunohistochemistry Carboxypeptidase E/CPE Antibody [Unconjugated]
(3 Publications)
Species: Hu
Applications: CyTOF-ready, ICC, IHC, IP, ICFlow, WB

Acetylcholinesterase/A
NB100-1519
Flow Cytometry Acetylcholinesterase/ACHE Antibody
Western Blot Acetylcholinesterase/ACHE Antibody
Immunocytochemistry/ Immunofluorescence Acetylcholinesterase/ACHE Antibody
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-FrFl, PEP-ELISA, WB
TLR5 Antibody
(19D759.2) - BSA Free
NBP2-24787
Immunocytochemistry/ Immunofluorescence TLR5 Antibody (19D759.2) - BSA Free
Immunohistochemistry TLR5 Antibody (19D759.2) - BSA Free
Flow Cytometry TLR5 Antibody (19D759.2) - BSA Free
(1 Review)
(42 Publications)
Species: Ca, Hu, Mu
Applications: DB, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
TLR3 Antibody
(40C1285.6) - BSA Fre
NBP2-24875
Flow Cytometry TLR3 Antibody (40C1285.6) - BSA Free
Western Blot TLR3 Antibody (40C1285.6) - BSA Free
Flow Cytometry TLR3 Antibody (40C1285.6) - BSA Free
(87 Publications)
Species: Ca, Hu, Mu
Applications: BA, B/N, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
mGluR5/1 Antibody
NB300-126
Western Blot mGluR5/1 Antibody
(1 Review)
(4 Publications)
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB

Butyrylcholinesterase/ ...
AF9024
Western Blot Butyrylcholinesterase/BCHE Antibody [Unconjugated]
Immunohistochemistry Butyrylcholinesterase/BCHE Antibody [Unconjugated]
(2 Publications)
Species: Mu, Rt
Applications: IHC, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
TLR6 Antibody
(86B1153.2) - BSA Fre
NB100-56536
Immunohistochemistry-Paraffin TLR6 Antibody (86B1153.2) - BSA Free
Flow (Intracellular) TLR6 Antibody (86B1153.2) - BSA Free
Flow Cytometry TLR6 Antibody (86B1153.2) - BSA Free
(19 Publications)
Species: Hu
Applications: Flow-CS, Flow-IC, Flow, IHC, IHC-P, WB
IL-2 [Unconjugated]
202-IL
Bioactivity IL-2 [Unconjugated]
(4 Reviews)
(374 Publications)
Species: Hu
Applications: BA

Publications for MYCBP2 Recombinant Protein Antigen (NBP2-68745PEP) (0)

There are no publications for MYCBP2 Recombinant Protein Antigen (NBP2-68745PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MYCBP2 Recombinant Protein Antigen (NBP2-68745PEP) (0)

There are no reviews for MYCBP2 Recombinant Protein Antigen (NBP2-68745PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MYCBP2 Recombinant Protein Antigen (NBP2-68745PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MYCBP2 Products

Array NBP2-68745PEP

Blogs on MYCBP2

There are no specific blogs for MYCBP2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
As an alternative, please consider our next generation Recombinant Human IL-2 (BT-002). It has equivalent bioactivity to Recombinant Human IL-2 (Catalog # 202-IL). It combines R&D Systems quality with scalability that allows for a solid supply chain. Both Recombinant Human IL-2 proteins are measured in a cell proliferation assay using CTLL 2 mouse cytotoxic T cells.
IL-2 [Unconjugated]
202-IL-010

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MYCBP2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol MYCBP2