![Immunocytochemistry/Immunofluorescence: MMP-8 Antibody [NBP1-85576] - Neurophil MMP-8 associates with NETs. Neutrophils were infected with M.tb MOI of 10 for 4 hours and NETs stained with DAPI (blue), anti-histone 2B (H2B, green) or anti-MMP-8 (green), while M.tb was stained with anti-M.tb Ab (red). Mtb induces NET formation which do not adhere to the shape of the neutrophil nuclei (White arrows). Scale bars represent 25 um. Image collected and cropped by CiteAb from the following publication (dx.plos.org/10.1371/journal.ppat.1004917), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/MMP-8-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85576-img0004.jpg "Immunocytochemistry/Immunofluorescence: MMP-8 Antibody [NBP1-85576] - Neurophil MMP-8 associates with NETs. Neutrophils were infected with M.tb MOI of 10 for 4 hours and NETs stained with DAPI (blue), anti-histone 2B (H2B, green) or anti-MMP-8 (green), while M.tb was stained with anti-M.tb Ab (red). Mtb induces NET formation which do not adhere to the shape of the neutrophil nuclei (White arrows). Scale bars represent 25 um. Image collected and cropped by CiteAb from the following publication (dx.plos.org/10.1371/journal.ppat.1004917), licensed under a CC-BY license.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KWERTNLTYRIRNYTPQLSEAEVERAIKDAFELWSVASPLIFTRISQGEADINIAFYQRDHGDNSPFDGPNG |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MMP8 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Neutralization CXCL8/IL-8 Antibody (6217) [Unconjugated]](https://images.novusbio.com/images2/CXCL8_MAB208_Block_Neutralize_9064.jpg)
![Immunocytochemistry CXCL8/IL-8 Antibody (6217) [Unconjugated]](https://images.novusbio.com/images2/CXCL8_MAB208_Immunocytochemistry_9339.jpg)
![Western Blot CXCL8/IL-8 Antibody (6217) [Unconjugated]](https://images.novusbio.com/images2/mab208_human-il-8-cxcl8-mab-clone-6217-western-blot-1882021143847.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for MMP-8 Antibody (NBP1-85576)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MMP8 |
![Immunohistochemistry-Paraffin: MMP-8 Antibody [NBP1-85576] - Neutrophil MMP-8 and -9 are upregulated in human TB. Magnified H&E and MMP-8 stains from Fig 1C inset shows neutrophils immunoreactive for MMP-8 around the cavity wall. Scale bar represent 50 um. Image collected and cropped by CiteAb from the following publication (journals.plos.org/plospathogens/article?id=10.1371/journal.ppat.1004917), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/MMP-8-Antibody-Immunohistochemistry-Paraffin-NBP1-85576-img0003.jpg "Immunohistochemistry-Paraffin: MMP-8 Antibody [NBP1-85576] - Neutrophil MMP-8 and -9 are upregulated in human TB. Magnified H&E and MMP-8 stains from Fig 1C inset shows neutrophils immunoreactive for MMP-8 around the cavity wall. Scale bar represent 50 um. Image collected and cropped by CiteAb from the following publication (journals.plos.org/plospathogens/article?id=10.1371/journal.ppat.1004917), licensed under a CC-BY license.")
![Immunohistochemistry-Paraffin: MMP8 Antibody [NBP1-85576] - Staining of human spleen shows strong cytoplasmic positivity in cells of red pulp.](http://images.novusbio.com/fullsize/MMP8-Antibody-Immunohistochemistry-Paraffin-NBP1-85576-img0002.jpg "Immunohistochemistry-Paraffin: MMP8 Antibody [NBP1-85576] - Staining of human spleen shows strong cytoplasmic positivity in cells of red pulp.")
![N/A MMP-9 [HRP]](https://images.novusbio.com/images2/MMP-9_DMP900_ELISA_148.jpg)
![N/A MMP-9 [HRP]](https://images.novusbio.com/images2/DATA_MMP9_DMP900_ELISA_770.jpg)
![N/A MMP-2 [HRP]](https://images.novusbio.com/images2/DATA_MMP2_MMP200_ELISA_1003.jpg)
![N/A MMP-2 [HRP]](https://images.novusbio.com/images2/MMP2_MMP200_ELISA_474.jpg)
![N/A TIMP-1 [HRP]](https://images.novusbio.com/images2/DATA_TIMP1_DTM100_ELISA_847.jpg)
![N/A TIMP-1 [HRP]](https://images.novusbio.com/images2/TIMP-1_DTM100_ELISA_194.jpg)
![N/A MMP-13 [HRP]](https://images.novusbio.com/images2/MMP-13_DM1300_ELISA_136.jpg)
![N/A MMP-13 [HRP]](https://images.novusbio.com/images2/DATA_MMP13_DM1300_ELISA_751.jpg)
![Knockout Validated MMP-1 Antibody (36665) [Unconjugated]](https://images.novusbio.com/images2/MMP1_MAB901_Knockout_Validated_21762.jpg)
![Immunohistochemistry MMP-1 Antibody (36665) [Unconjugated]](https://images.novusbio.com/images2/MMP-1_MAB901_Immunohistochemistry_7049.jpg)
![Immunohistochemistry MMP-1 Antibody (36665) [Unconjugated]](https://images.novusbio.com/images2/MMP-1_MAB901_Immunohistochemistry_9677.jpg)
![N/A MMP-3 [HRP]](https://images.novusbio.com/images2/DATA_MMP3_DMP300_ELISA_767.jpg)
![N/A MMP-3 [HRP]](https://images.novusbio.com/images2/MMP-3_DMP300_ELISA_145.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![N/A TIMP-2 [HRP]](https://images.novusbio.com/images2/DATA_TIMP2_DTM200_ELISA_848.jpg)
![N/A TIMP-2 [HRP]](https://images.novusbio.com/images2/DATA_TIMP2_DTM200_ELISA_849.jpg)
![N/A TIMP-2 [HRP]](https://images.novusbio.com/images2/TIMP2_DTM200_ELISA_2722.jpg)
![N/A MMP-7 [HRP]](https://images.novusbio.com/images2/MMP7_DMP700_ELISA_498.jpg)
![N/A MMP-7 [HRP]](https://images.novusbio.com/images2/DATA_MMP7_DMP700_ELISA_768.jpg)
![Flow Cytometry MMP-14/MT1-MMP Antibody (128527) [Unconjugated]](https://images.novusbio.com/images2/MMP-14_MAB9181_Flow_Cytometry_11258.jpg)
![Immunohistochemistry MMP-14/MT1-MMP Antibody (128527) [Unconjugated]](https://images.novusbio.com/images2/mab9181_human-mmp-14-mt1-mmp-mab-clone-128527-immunohistochemistry-239202215152.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![N/A Neutrophil Elastase/ELA2 [Biotin]](https://images.novusbio.com/images2/DATA_Neutrophil_Elastase_DY451705_ELISA_2461.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")