![Western Blot: MMP-7 Antibody (9D8S10) [NBP3-16067] - Analysis of extracts of various cell lines, using MMP-7 antibody (NBP3-16067 ) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.](http://images.novusbio.com/fullsize/MMP-7-Antibody-9D8S10-Western-Blot-NBP3-16067-img0005.jpg "Western Blot: MMP-7 Antibody (9D8S10) [NBP3-16067] - Analysis of extracts of various cell lines, using MMP-7 antibody (NBP3-16067 ) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clone | 8T4R8 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-267 of human MMP7 (P09237). MRLTVLCAVCLLPGSLALPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLKEMQKFFGLPITGMLNSRVIEIMQKPRCGVPDVAEYSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGKRSNSRKK |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | MMP7 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Reviewed Applications |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative | 0.05% Proclin 300 |
| Purity | Affinity purified |
![Western Blot beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/beta-Catenin_AF1329_Western_Blot_5100.jpg)
![Chromatin Immunoprecipitation (ChIP) beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/beta-Catenin_AF1329_Chromatin_Immunoprecipitation_11251.jpg)
![Simple Western beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/betaCatenin_AF1329_Simple_Western_17134.jpg)
![Immunohistochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunohistochemistry_20892.jpg)
![Immunocytochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunocytochemistry__Immunofluorescence_21143.jpg)
![Western Blot EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Western_Blot_19925.jpg)
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
reviewed by:
Shinford Sun |
WB | Human | 05/24/2024 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for MMP-7 Antibody (NBP3-16067)Find related products by research area.
|
|
Toll-like receptors in the intestinal epithelial cells By Jamshed Arslan, Pharm. D., PhD. Toll-like receptors (TLRs) are microbe-sensing proteins that act as first responders to danger signals. TLRs help the intestinal epithelial cells (IECs) recognize commensal bacteria ... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MMP7 |
![Immunohistochemistry-Paraffin: MMP-7 Antibody (9D8S10) [NBP3-16067] - Human prostate cancer using MMP-7 Rabbit mAb (NBP3-16067) at dilution of 1:150 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/MMP-7-Antibody-9D8S10-Immunohistochemistry-Paraffin-NBP3-16067-img0004.jpg "Immunohistochemistry-Paraffin: MMP-7 Antibody (9D8S10) [NBP3-16067] - Human prostate cancer using MMP-7 Rabbit mAb (NBP3-16067) at dilution of 1:150 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.")
![Immunohistochemistry-Paraffin: MMP-7 Antibody (9D8S10) [NBP3-16067] - Human brain using MMP-7 Rabbit mAb (NBP3-16067) at dilution of 1:150 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/MMP-7-Antibody-9D8S10-Immunohistochemistry-Paraffin-NBP3-16067-img0001.jpg "Immunohistochemistry-Paraffin: MMP-7 Antibody (9D8S10) [NBP3-16067] - Human brain using MMP-7 Rabbit mAb (NBP3-16067) at dilution of 1:150 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.")
![Immunohistochemistry-Paraffin: MMP-7 Antibody (9D8S10) [NBP3-16067] - Human breast cancer using MMP-7 Rabbit mAb (NBP3-16067) at dilution of 1:150 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/MMP-7-Antibody-9D8S10-Immunohistochemistry-Paraffin-NBP3-16067-img0002.jpg "Immunohistochemistry-Paraffin: MMP-7 Antibody (9D8S10) [NBP3-16067] - Human breast cancer using MMP-7 Rabbit mAb (NBP3-16067) at dilution of 1:150 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.")
![Immunohistochemistry-Paraffin: MMP-7 Antibody (9D8S10) [NBP3-16067] - Human colon carcinoma using MMP-7 Rabbit mAb (NBP3-16067) at dilution of 1:150 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/MMP-7-Antibody-9D8S10-Immunohistochemistry-Paraffin-NBP3-16067-img0003.jpg "Immunohistochemistry-Paraffin: MMP-7 Antibody (9D8S10) [NBP3-16067] - Human colon carcinoma using MMP-7 Rabbit mAb (NBP3-16067) at dilution of 1:150 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.")
![N/A MMP-2 [HRP]](https://images.novusbio.com/images2/DATA_MMP2_MMP200_ELISA_1003.jpg)
![N/A MMP-2 [HRP]](https://images.novusbio.com/images2/MMP2_MMP200_ELISA_474.jpg)
![N/A MMP-9 [HRP]](https://images.novusbio.com/images2/MMP-9_DMP900_ELISA_148.jpg)
![N/A MMP-9 [HRP]](https://images.novusbio.com/images2/DATA_MMP9_DMP900_ELISA_770.jpg)
![N/A TIMP-1 [HRP]](https://images.novusbio.com/images2/DATA_TIMP1_DTM100_ELISA_847.jpg)
![N/A TIMP-1 [HRP]](https://images.novusbio.com/images2/TIMP-1_DTM100_ELISA_194.jpg)
![N/A MMP-3 [HRP]](https://images.novusbio.com/images2/DATA_MMP3_DMP300_ELISA_767.jpg)
![N/A MMP-3 [HRP]](https://images.novusbio.com/images2/MMP-3_DMP300_ELISA_145.jpg)
![Knockout Validated MMP-1 Antibody (36665) [Unconjugated]](https://images.novusbio.com/images2/MMP1_MAB901_Knockout_Validated_21762.jpg)
![Immunohistochemistry MMP-1 Antibody (36665) [Unconjugated]](https://images.novusbio.com/images2/MMP-1_MAB901_Immunohistochemistry_7049.jpg)
![Immunohistochemistry MMP-1 Antibody (36665) [Unconjugated]](https://images.novusbio.com/images2/MMP-1_MAB901_Immunohistochemistry_9677.jpg)
![N/A TIMP-2 [HRP]](https://images.novusbio.com/images2/DATA_TIMP2_DTM200_ELISA_848.jpg)
![N/A TIMP-2 [HRP]](https://images.novusbio.com/images2/DATA_TIMP2_DTM200_ELISA_849.jpg)
![N/A TIMP-2 [HRP]](https://images.novusbio.com/images2/TIMP2_DTM200_ELISA_2722.jpg)
![Flow Cytometry MMP-14/MT1-MMP Antibody (128527) [Unconjugated]](https://images.novusbio.com/images2/MMP-14_MAB9181_Flow_Cytometry_11258.jpg)
![Immunohistochemistry MMP-14/MT1-MMP Antibody (128527) [Unconjugated]](https://images.novusbio.com/images2/mab9181_human-mmp-14-mt1-mmp-mab-clone-128527-immunohistochemistry-239202215152.jpg)
![N/A MMP-13 [HRP]](https://images.novusbio.com/images2/MMP-13_DM1300_ELISA_136.jpg)
![N/A MMP-13 [HRP]](https://images.novusbio.com/images2/DATA_MMP13_DM1300_ELISA_751.jpg)
![Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Western_Blot_18923.jpg)
![Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Immunocytochemistry__Immunofluorescence_18945.jpg)
![Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Simple_Western_19175.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_871.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_872.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/VEGF_DVE00_ELISA_208.jpg)
![N/A MMP-10 [HRP]](https://images.novusbio.com/images2/DATA_MMP10_DM1000_ELISA_750.jpg)
![N/A MMP-10 [HRP]](https://images.novusbio.com/images2/MMP-10_DM1000_ELISA_135.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
