![Immunohistochemistry-Paraffin: Melatonin R1A/MT1/MTNR1A Antibody [NBP3-03633] - Mouse brain using Melatonin R1A/MT1/MTNR1A antibody at dilution of 1:100 (40x lens).](http://images.novusbio.com/fullsize/Melatonin-R1A-MT1-MTNR1A-Antibody-Immunohistochemistry-Paraffin-NBP3-03633-img0002.jpg "Immunohistochemistry-Paraffin: Melatonin R1A/MT1/MTNR1A Antibody [NBP3-03633] - Mouse brain using Melatonin R1A/MT1/MTNR1A antibody at dilution of 1:100 (40x lens).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 281-350 of human Melatonin R1A/MT1/MTNR1A (NP_005949.1). YYMAYFNSCLNAIIYGLLNQNFRKEYRRIIVSLCTARVFFVDSSNDVADRVKWKPSPLMTNNNVVKVDSV |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MTNR1A |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Theoretical MW | 39 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Publications |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS with 50% glycerol, pH7.3. |
| Preservative | 0.05% Proclin 300 |
| Purity | Affinity purified |
![Western Blot Serotonin N-acetyltransferase [p Thr29] Antibody - BSA Free](https://images.novusbio.com/images/Serotonin-N-acetyltransferase-[p-Thr29]-Antibody-Western-Blot-NB120-3439-img0003.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Melatonin R1A/MT1/MTNR1A Antibody (NBP3-03633)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MTNR1A |
![Immunohistochemistry-Paraffin: Melatonin R1A/MT1/MTNR1A Antibody [NBP3-03633] - Rat brain using Melatonin R1A/MT1/MTNR1A antibody at dilution of 1:100 (40x lens).](http://images.novusbio.com/fullsize/Melatonin-R1A-MT1-MTNR1A-Antibody-Immunohistochemistry-Paraffin-NBP3-03633-img0001.jpg "Immunohistochemistry-Paraffin: Melatonin R1A/MT1/MTNR1A Antibody [NBP3-03633] - Rat brain using Melatonin R1A/MT1/MTNR1A antibody at dilution of 1:100 (40x lens).")
![Western Blot: Melatonin R1A/MT1/MTNR1A Antibody [NBP3-03633] - analysis of Mouse eye, using MTNR1A antibody at 1:2000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 60s.](http://images.novusbio.com/fullsize/antibody/nbp3-03633_rabbit-polyclonal-melatonin-r1a-mt1-mtnr1a-antibody-western-blot-31120239326..jpg "Western Blot: Melatonin R1A/MT1/MTNR1A Antibody [NBP3-03633] - analysis of Mouse eye, using MTNR1A antibody at 1:2000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 60s.")
![Flow Cytometry MMP-14/MT1-MMP Antibody (128527) [Unconjugated]](https://images.novusbio.com/images2/MMP-14_MAB9181_Flow_Cytometry_11258.jpg)
![Immunohistochemistry MMP-14/MT1-MMP Antibody (128527) [Unconjugated]](https://images.novusbio.com/images2/mab9181_human-mmp-14-mt1-mmp-mab-clone-128527-immunohistochemistry-239202215152.jpg)
![N/A MMP-2 [HRP]](https://images.novusbio.com/images2/DATA_MMP2_MMP200_ELISA_1003.jpg)
![N/A MMP-2 [HRP]](https://images.novusbio.com/images2/MMP2_MMP200_ELISA_474.jpg)
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![N/A TIMP-1 [HRP]](https://images.novusbio.com/images2/DATA_TIMP1_DTM100_ELISA_847.jpg)
![N/A TIMP-1 [HRP]](https://images.novusbio.com/images2/TIMP-1_DTM100_ELISA_194.jpg)
![N/A MMP-9 [HRP]](https://images.novusbio.com/images2/MMP-9_DMP900_ELISA_148.jpg)
![N/A MMP-9 [HRP]](https://images.novusbio.com/images2/DATA_MMP9_DMP900_ELISA_770.jpg)
![N/A TIMP-2 [HRP]](https://images.novusbio.com/images2/DATA_TIMP2_DTM200_ELISA_848.jpg)
![N/A TIMP-2 [HRP]](https://images.novusbio.com/images2/DATA_TIMP2_DTM200_ELISA_849.jpg)
![N/A TIMP-2 [HRP]](https://images.novusbio.com/images2/TIMP2_DTM200_ELISA_2722.jpg)
![Immunohistochemistry CD45 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD45_AF114_Immunohistochemistry_23525.jpg)
![Immunocytochemistry CD45 Antibody [Unconjugated]](https://images.novusbio.com/images2/af114_mouse-cd45-affinity-purified-polyclonal-ab-immunocytochemistry-6122021145449.jpg)
![Immunocytochemistry/ Immunofluorescence CD45 Antibody [Unconjugated]](https://images.novusbio.com/images/af114_mouse-cd45-affinity-purified-polyclonal-ab-41202410331954.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")