MEKK3 Antibody (9N3Y9) Summary
Additional Information |
Recombinant Monoclonal Antibody |
Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MEKK3 (Q99759). MDEQEALNSIMNDLVALQMNRRHRMPGYETMKNKDTGHSNRQSDVRIKFEHNGERRIIAFSRPVKYEDVEHKVTTVFGQPLDLHYMNNELSILLKNQDDL |
Isotype |
IgG |
Clonality |
Monoclonal |
Host |
Rabbit |
Gene |
MAP3K3 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Western Blot 1:500 - 1:2000
|
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS, 0.05% BSA, 50% glycerol, pH7.3 |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for MEKK3 Antibody (9N3Y9)
Background
MEKK3 is a Ser/Thr protein kinase belonging to the MAP/ERK kinase kinase family (1). Closely related to MEKK2, MEKK3 is expressed in a multitude of tissues. MEKK3 directly regulates SAPKs and ERKs pathway via SEK and MEK1, respectively but not the p38 pathway (2) and is also involved in the NF-kB pathway (3). MEKK3 as well as MEKK2 bind, phosphorylate and activate MEK5 through their PB1 domain (4). hKSR-2 (human kinase suppressor of ras-2) has been shown to regulate the activity of MEKK3 (5).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: WB
Publications for MEKK3 Antibody (NBP3-16252) (0)
There are no publications for MEKK3 Antibody (NBP3-16252).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MEKK3 Antibody (NBP3-16252) (0)
There are no reviews for MEKK3 Antibody (NBP3-16252).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for MEKK3 Antibody (NBP3-16252) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MEKK3 Products
Research Areas for MEKK3 Antibody (NBP3-16252)
Find related products by research area.
|
Blogs on MEKK3