Reactivity | Hu, Mu, RtSpecies Glossary |
Applications | ICC/IF, IHC |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LMHQRMFKKEQRDSSKDKMLAPDPDPNGELLPGSPNPEEPI |
Predicted Species | Rat (90%). Backed by our 100% Guarantee. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | SLC16A2 |
Purity | Affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC-P Retrieval method: HIER pH6. |
||
Control Peptide |
|
||
Publications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Affinity purified |
Publications using NBP2-57308 | Applications | Species |
---|---|---|
Wang Y, Wang T, Montero-Pedrazuela A et al. Thyroid Hormone Transporters MCT8 and OATP1C1 Are Expressed in Pyramidal Neurons and Interneurons in the Adult Motor Cortex of Human and Macaque Brain International journal of molecular sciences 2023-02-06 [PMID: 36834621] | ||
Graffunder AS, Paisdzior S, Opitz R Et al. Design and Characterization of a Fluorescent Reporter Enabling Live-cell Monitoring of MCT8 Expression Experimental and clinical endocrinology & diabetes : official journal, German Society of Endocrinology [and] German Diabetes Association 2021-08-05 [PMID: 34352913] | ||
Wilpert NM, Krueger M, Opitz R et al. Spatiotemporal Changes of Cerebral Monocarboxylate Transporter 8 Expression Thyroid 2020-03-06 [PMID: 32143555] (IF/IHC, Human) | IF/IHC | Human |
Porst T Detection and physiological role of autoimmunity against thyroid hormone transporters Thesis 2022-01-01 (Human) | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for MCT8/SLC16A2 Antibody (NBP2-57308)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | SLC16A2 |