![Immunocytochemistry/Immunofluorescence: MCT8/SLC16A2 Antibody [NBP2-57308] - Staining of human cell line U-251 MG shows localization to plasma membrane. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/MCT8-SLC16A2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-57308-img0001.jpg "Immunocytochemistry/Immunofluorescence: MCT8/SLC16A2 Antibody [NBP2-57308] - Staining of human cell line U-251 MG shows localization to plasma membrane. Antibody staining is shown in green.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LMHQRMFKKEQRDSSKDKMLAPDPDPNGELLPGSPNPEEPI |
| Predicted Species | Rat (90%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SLC16A2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC-P Retrieval method: HIER pH6. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Western Blot NTAL Antibody [Unconjugated]](https://images.novusbio.com/images2/NTAL_AF4066_Western_Blot_5396.jpg)
![Intracellular Staining by Flow Cytometry NTAL Antibody [Unconjugated]](https://images.novusbio.com/images2/NTAL_AF4066_Flow_Cytometry_8223.jpg)
| Publications using NBP2-57308 | Applications | Species |
|---|---|---|
| Wang Y, Wang T, Montero-Pedrazuela A et al. Thyroid Hormone Transporters MCT8 and OATP1C1 Are Expressed in Pyramidal Neurons and Interneurons in the Adult Motor Cortex of Human and Macaque Brain International journal of molecular sciences 2023-02-06 [PMID: 36834621] | ||
| Graffunder AS, Paisdzior S, Opitz R Et al. Design and Characterization of a Fluorescent Reporter Enabling Live-cell Monitoring of MCT8 Expression Experimental and clinical endocrinology & diabetes : official journal, German Society of Endocrinology [and] German Diabetes Association 2021-08-05 [PMID: 34352913] | ||
| Wilpert NM, Krueger M, Opitz R et al. Spatiotemporal Changes of Cerebral Monocarboxylate Transporter 8 Expression Thyroid 2020-03-06 [PMID: 32143555] (IF/IHC, Human) | IF/IHC | Human |
| Porst T Detection and physiological role of autoimmunity against thyroid hormone transporters Thesis 2022-01-01 (Human) | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for MCT8/SLC16A2 Antibody (NBP2-57308)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SLC16A2 |
![Immunohistochemistry-Paraffin: MCT8/SLC16A2 Antibody [NBP2-57308] - Staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.](http://images.novusbio.com/fullsize/MCT8-SLC16A2-Antibody-Immunohistochemistry-Paraffin-NBP2-57308-img0018.jpg "Immunohistochemistry-Paraffin: MCT8/SLC16A2 Antibody [NBP2-57308] - Staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.")
![Immunohistochemistry-Paraffin: MCT8/SLC16A2 Antibody [NBP2-57308] - Staining of mouse embryo E11 shows strong membranous positivity in the developing circumventricular organ.](http://images.novusbio.com/fullsize/MCT8-SLC16A2-Antibody-Immunohistochemistry-Paraffin-NBP2-57308-img0014.jpg "Immunohistochemistry-Paraffin: MCT8/SLC16A2 Antibody [NBP2-57308] - Staining of mouse embryo E11 shows strong membranous positivity in the developing circumventricular organ.")
![Immunohistochemistry-Paraffin: MCT8/SLC16A2 Antibody [NBP2-57308] - Staining of human cerebral cortex shows moderate positivity in neuropil.](http://images.novusbio.com/fullsize/MCT8-SLC16A2-Antibody-Immunohistochemistry-Paraffin-NBP2-57308-img0015.jpg "Immunohistochemistry-Paraffin: MCT8/SLC16A2 Antibody [NBP2-57308] - Staining of human cerebral cortex shows moderate positivity in neuropil.")
![Immunohistochemistry-Paraffin: MCT8/SLC16A2 Antibody [NBP2-57308] - Staining of human kidney shows moderate membranous positivity in cells in tubules.](http://images.novusbio.com/fullsize/MCT8-SLC16A2-Antibody-Immunohistochemistry-Paraffin-NBP2-57308-img0016.jpg "Immunohistochemistry-Paraffin: MCT8/SLC16A2 Antibody [NBP2-57308] - Staining of human kidney shows moderate membranous positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: MCT8/SLC16A2 Antibody [NBP2-57308] - Staining of human liver shows moderate to strong membranous positivity in hepatocytes.](http://images.novusbio.com/fullsize/MCT8-SLC16A2-Antibody-Immunohistochemistry-Paraffin-NBP2-57308-img0017.jpg "Immunohistochemistry-Paraffin: MCT8/SLC16A2 Antibody [NBP2-57308] - Staining of human liver shows moderate to strong membranous positivity in hepatocytes.")
![Western Blot Chymase/CMA1/Mast Cell Chymase Antibody (422818) [Unconjugated]](https://images.novusbio.com/images2/Chymase_MAB4099_Western_Blot_21236.jpg)
![ELISA Chymase/CMA1/Mast Cell Chymase Antibody (422818) [Unconjugated]](https://images.novusbio.com/images2/mab4099_human-chymase-cma1-mab-clone-422818-elisa-6122021135313.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")