Novus Biologicals products are now on bio-techne.com

MCT2 Recombinant Protein Antigen

Name: MCT2 Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP1-87846PEP
Price: 279 USD

Images

There are currently no images for MCT2 Protein (NBP1-87846PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

MCT2 Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SLC16A7. Source: E. coli Amino Acid Sequence: GPNQTTSKSKNKTGKTEDDSSPKKIKTKKSTWEKVNKYLDFS Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	SLC16A7
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87846. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	22 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MCT2 Recombinant Protein Antigen

MCT 2
MCT2
MCT2solute carrier family 16 (monocarboxylic acid transporters), member 7
monocarboxylate transporter 2
SLC16A7
Solute carrier family 16 member 7
solute carrier family 16, member 7 (monocarboxylic acid transporter 2)

Background

Lactic acid and pyruvate transport across plasma membranes is catalyzed by members of the proton-linked monocarboxylate transporter (MCT) family, which has been designated solute carrier family 16. Each MCT appears to have slightly different substrate and inhibitor specificities and transport kinetics, which are related to the metabolic requirements of the tissues in which it is found. MCT2 is a high affinity transporter that catalyzes the rapid transport of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate across the plasma membrane.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MCT1/SLC16A1
Antibody - BSA Free

NBP1-59656

Knockdown Validated MCT1/SLC16A1 Antibody - BSA Free

(15 Publications)

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P, KD, WB

MCTS1 Antibody
(OTI2F9)

NBP2-03626

Immunohistochemistry-Paraffin MCTS1 Antibody (OTI2F9)

Species: Hu, Mu, Rt

Applications: IHC, IHC-P, WB

Chymase/CMA1/Mast
Cell Chymase Antibody ...

MAB4099

ELISA Chymase/CMA1/Mast Cell Chymase Antibody (422818) [Unconjugated]

(2 Reviews)

(3 Publications)

Species: Hu

Applications: ELISA, IP, WB

SLC16A3 Antibody

NBP1-81251

Immunohistochemistry-Paraffin SLC16A3 Antibody

(1 Review)

(6 Publications)

Species: Hu, Mu

Applications: IB, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB

SLC16A4 Antibody

NBP2-13315

(1 Publication)

Species: Hu

Applications: ICC/IF, IHC, IHC-P

MCPH1 Antibody

AF3998

(1 Review)

(4 Publications)

Species: Hu

Applications: WB

MCAT Antibody (2F2)

H00027349-M01

Species: Hu

Applications: ELISA, IHC, IHC-P, S-ELISA, WB

Glut1 Antibody -
BSA Free

NB110-39113

Flow Cytometry Glut1 Antibody - BSA Free

(7 Reviews)

(62 Publications)

Species: Hu, Mu, Rb, Rt

Applications: ChIP, ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, Simple Western, WB

EMMPRIN/CD147
Antibody [Unconjugate

AF972

Immunohistochemistry EMMPRIN/CD147 Antibody [Unconjugated]

Knockout Validated EMMPRIN/CD147 Antibody [Unconjugated]

(1 Review)

(15 Publications)

Species: Hu

Applications: ELISA, IHC, KO, Simple Western, WB

Glut3 Antibody
(202017) [Unconjugate

MAB1415

Immunocytochemistry Glut3 Antibody (202017) [Unconjugated]

(7 Publications)

Species: Hu

Applications: CyTOF-ready, Flow, ICC

MCT3/SLC16A8
Antibody

NBP1-59885

Immunohistochemistry-Paraffin MCT3/SLC16A8 Antibody

(1 Review)

Species: Hu, Mu

Applications: IHC, IHC-P, WB

Glut4 Antibody -
BSA Free

NBP1-49533

(4 Reviews)

(41 Publications)

Species: Hu, Mu, Pl, Rt

Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB

Insulin Antibody
(182410) [Unconjugate ...

MAB1417

Immunohistochemistry Insulin Antibody (182410) [Unconjugated]

(24 Publications)

Species: Bv, Hu, Mu

Applications: CyTOF-ready, ICC, IHC, ICFlow

Glucokinase/GCK
Antibody (OTI3E3)

NBP1-47778

Immunohistochemistry-Paraffin Glucokinase/GCK Antibody (OTI3E3)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

Embigin/EMB
Antibody

NBP2-24689

(2 Publications)

Species: Hu, Mu

Applications: WB

MCT8/SLC16A2
Antibody

NBP2-57308

(5 Publications)

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P

SLC5A8/SMCT1
Antibody (903502)

MAB8398

Species: Hu

Applications: CyTOF-ready, Flow

GFAP Antibody

NB300-141

(12 Reviews)

(108 Publications)

Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt

Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB

PSMC6 Antibody
(2C4)

H00005706-M02

Immunocytochemistry/ Immunofluorescence PSMC6 Antibody (2C4)

Species: Hu, Mu, Rt

Applications: ELISA, ICC/IF, KD, WB

MCT2 Recombinant
Protein Antigen

NBP1-87846PEP

Species: Hu

Applications: AC

Publications for MCT2 Protein (NBP1-87846PEP) (0)

There are no publications for MCT2 Protein (NBP1-87846PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MCT2 Protein (NBP1-87846PEP) (0)

There are no reviews for MCT2 Protein (NBP1-87846PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MCT2 Protein (NBP1-87846PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MCT2 Products

Research Areas for MCT2 Protein (NBP1-87846PEP)

Find related products by research area.

Lipid and Metabolism

Blogs on MCT2

There are no specific blogs for MCT2, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

GFAP Antibody
NB300-141

Western Blot: Glut1 Antibody [NB110-39113] - Glut1 in human brain lysate (55 kDa). Antibody at 1:500. Western blot image submitted by a verified customer review.

Glut1 Antibody - BSA Free
NB110-39113

Flow (Intracellular): Glut4 Antibody [NBP1-49533] - An intracellular stain was performed on HepG2 with NBP1-49533 and a matched isotype control. Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature, followed by Rabbit IgG (H+L) Cross-Adsorbed Secondary Antibody.

Glut4 Antibody - BSA Free
NBP1-49533

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our MCT2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

SLC16A7

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

MCT2 Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

MCT2 Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for MCT2 Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for MCT2 Protein (NBP1-87846PEP) (0)

Reviews for MCT2 Protein (NBP1-87846PEP) (0)

FAQs for MCT2 Protein (NBP1-87846PEP) (0)

Additional MCT2 Products

Research Areas for MCT2 Protein (NBP1-87846PEP)

Blogs on MCT2

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics