Novus Biologicals products are now on bio-techne.com

MCPH1 Recombinant Protein Antigen

Name: MCPH1 Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP1-89937PEP
Price: 279 USD

Images

There are currently no images for MCPH1 Protein (NBP1-89937PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

MCPH1 Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MCPH1. Source: E. coli Amino Acid Sequence: AVGLKSTQNKGTTSKISNSSEGEAQSEHEPCFIVDCNMETSTEEKENLPGGYSGSVKNRPTRHDVLDDSCDGFKDLIKPHEELKKSGRGKKPTRTLVMTSMPSEKQNVVIQVVDKLKGFSIAPDVCETTTHVLSGKPLRTLNVLLGI Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	MCPH1
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89937. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com For further blocking peptide related information and a protocol, click here.
Theoretical MW	34 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MCPH1 Recombinant Protein Antigen

BRCT-repeat inhibitor of TERT expression 1
BRIT1
FLJ12847
MCPH1
MCT
microcephalin 1
Microcephalin
microcephaly, primary autosomal recessive 1

Background

MCPH-1 was identified in a screen for negative regulators of hTERT (human telomerase) expression. It has been implicated in chromosome condensation and DNA damage induced cellular responses. It may play a role in neurogenesis and regulation of the size of the cerebral cortex. Defects in MCPH1 are the cause of primary microcephaly 1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Lactase Antibody

NBP3-12238

Species: Hu, Mu, Rt

Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB

Chymase/CMA1/Mast
Cell Chymase Antibody ...

MAB4099

ELISA Chymase/CMA1/Mast Cell Chymase Antibody (422818) [Unconjugated]

(2 Reviews)

(3 Publications)

Species: Hu

Applications: IP, WB

MCT1/SLC16A1
Antibody - BSA Free

NBP1-59656

Knockdown Validated MCT1/SLC16A1 Antibody - BSA Free

(15 Publications)

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P, KD, WB

MCTS1 Antibody
(OTI2F9)

NBP2-03626

Immunohistochemistry-Paraffin MCTS1 Antibody (OTI2F9)

Species: Hu, Mu, Rt

Applications: IHC, IHC-P, WB

SLC16A4 Antibody

NBP2-13315

(1 Publication)

Species: Hu

Applications: ICC/IF, IHC, IHC-P

SLC16A3 Antibody

NBP1-81251

Immunohistochemistry-Paraffin SLC16A3 Antibody

(1 Review)

(6 Publications)

Species: Hu, Mu

Applications: IB, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB

MCT2 Antibody

NB300-877

(2 Publications)

Species: Hu

Applications: IHC, IHC-P, PEP-ELISA, WB

EMMPRIN/CD147
Antibody [Unconjugate

AF972

Immunohistochemistry EMMPRIN/CD147 Antibody [Unconjugated]

Knockout Validated EMMPRIN/CD147 Antibody [Unconjugated]

(1 Review)

(15 Publications)

Species: Hu

Applications: ELISA, IHC, KO, Simple Western, WB

TNF-alpha
[Unconjugated]

210-TA

(3 Reviews)

(803 Publications)

Species: Hu

Applications: BA

Phenylalanine
Hydroxylase Antibody

NBP2-48615

(1 Publication)

Species: Hu

Applications: IHC, IHC-P, WB

ASPM Antibody

NB100-2278

(10 Publications)

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P

Procalcitonin
Antibody (44D9)

NB120-14817

(1 Review)

(11 Publications)

Species: Hu, Rt

Applications: ICC/IF, IHC, S-ELISA, WB

Insulin Antibody
(182410) [Unconjugate ...

MAB1417

Immunohistochemistry Insulin Antibody (182410) [Unconjugated]

(24 Publications)

Species: Bv, Hu, Mu

Applications: CyTOF-ready, ICC, IHC, ICFlow

Albumin Antibody
(188835) [Unconjugate ...

MAB1455

Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum

Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum

(3 Reviews)

(54 Publications)

Species: Hu

Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB

Chk1 Antibody

NB100-464

Immunohistochemistry-Paraffin Chk1 Antibody

(12 Publications)

Species: Hu, Mu

Applications: IHC, IHC-P, IP, WB

Thyroglobulin
Antibody (2H11 + 6E1)

NBP2-34294

Immunohistochemistry Thyroglobulin Antibody (2H11 + 6E1)

(3 Reviews)

(1 Publication)

Species: Hu, Mu, Rt

Applications: Flow, IHC, IHC-P

eNOS Antibody -
BSA Free

NB300-500

Immunohistochemistry-Paraffin eNOS Antibody - BSA Free

(3 Reviews)

(28 Publications)

Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh

Applications: IHC, IHC-Fr, IHC-P, WB

Neurophysin
II/Arg-vasopressin An ...

AF009

Species: Hu

Applications: IHC, WB

Publications for MCPH1 Protein (NBP1-89937PEP) (0)

There are no publications for MCPH1 Protein (NBP1-89937PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MCPH1 Protein (NBP1-89937PEP) (0)

There are no reviews for MCPH1 Protein (NBP1-89937PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MCPH1 Protein (NBP1-89937PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MCPH1 Products

Research Areas for MCPH1 Protein (NBP1-89937PEP)

Find related products by research area.

DNA Repair

Blogs on MCPH1

There are no specific blogs for MCPH1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.

TNF-alpha [Unconjugated]
210-TA-005

Western blot shows lysates of HepG2 human hepatocellular carcinoma cell line, CHP-100 human neuroblastoma cell line, PC-12 rat adrenal pheochromocytoma cell line, Rat-2 rat embryonic fibroblast cell line, and Neuro-2A mouse neuroblastoma cell line. PVDF membrane was probed with 1 µg/mL of Human MCPH1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3998) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for MCPH1 at approximately 105 kDa (as indicated). This experiment was conducted using Immunoblot Buffer Group 1.

MCPH1 Antibody
AF3998

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our MCPH1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

MCPH1

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

MCPH1 Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

MCPH1 Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for MCPH1 Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for MCPH1 Protein (NBP1-89937PEP) (0)

Reviews for MCPH1 Protein (NBP1-89937PEP) (0)

FAQs for MCPH1 Protein (NBP1-89937PEP) (0)

Additional MCPH1 Products

Research Areas for MCPH1 Protein (NBP1-89937PEP)

Blogs on MCPH1

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics