![ELISA: MCPH1 Antibody (5C9) [H00079648-M07] - Detection limit for recombinant GST tagged MCPH1 is approximately 0.03ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/MCPH1-Antibody-5C9-ELISA-H00079648-M07-img0001.jpg "ELISA: MCPH1 Antibody (5C9) [H00079648-M07] - Detection limit for recombinant GST tagged MCPH1 is approximately 0.03ng/ml as a capture antibody.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA |
| Clone | 5C9 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | MCPH1 (NP_078872, 399 a.a. ~ 487 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ATSSCVTSAPEEALRCCRQAGKEDACPEGNGFSYTIEDPALPKGHDDDLTPLEGSLEEMKEAVGLKSTQNKGTTSKISNSSEGEAQSEH |
| Specificity | MCPH1 - microcephaly, primary autosomal recessive 1 |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | MCPH1 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
![Immunohistochemistry Neurophysin II/Arg-vasopressin Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af009_human-neurophysin-ii-affinity-purified-polyclonal-ab-immunohistochemistry-2812202013195.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for MCPH1 Antibody (H00079648-M07)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot Chymase/CMA1/Mast Cell Chymase Antibody (422818) [Unconjugated]](https://images.novusbio.com/images2/Chymase_MAB4099_Western_Blot_21236.jpg)
![ELISA Chymase/CMA1/Mast Cell Chymase Antibody (422818) [Unconjugated]](https://images.novusbio.com/images2/mab4099_human-chymase-cma1-mab-clone-422818-elisa-6122021135313.jpg)
![Western Blot EMMPRIN/CD147 Antibody [Unconjugated]](https://images.novusbio.com/images2/EMMPRIN_AF972_Western_Blot_16707.jpg)
![Immunohistochemistry EMMPRIN/CD147 Antibody [Unconjugated]](https://images.novusbio.com/images2/EMMPRIN_AF972_Immunohistochemistry_17212.jpg)
![Knockout Validated EMMPRIN/CD147 Antibody [Unconjugated]](https://images.novusbio.com/images2/EMMPRIN_AF972_Knockout_Validated_22526.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.](https://images.novusbio.com/images/Mouse-IgG1-Kappa-Light-Chain-Isotype-Control-P3-6-2-8-1-Flow-Cytometry-NBP1-43319-img0002.jpg "Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.")