![Immunohistochemistry-Paraffin: MBNL3 Antibody [NBP1-85635] - Staining in human placenta and prostate tissues using anti-MBNL3 antibody. Corresponding MBNL3 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/MBNL3-Antibody-Immunohistochemistry-Paraffin-NBP1-85635-img0011.jpg "Immunohistochemistry-Paraffin: MBNL3 Antibody [NBP1-85635] - Staining in human placenta and prostate tissues using anti-MBNL3 antibody. Corresponding MBNL3 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: AQMSSLGSFPMTPSIPANPPMAFNPYIPHPGMGLVPAELVPNTPVLIPGNPPLAMPGAVGPKLMRSDKLEVCREFQRGNCTRGENDCRYAHPTDASMIEASDNTVTICMDYIKGRCSREKCKYFHPPAHLQARLKAAHHQMNHSAAS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MBNL3 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MBNL3 |
![Western Blot: MBNL3 Antibody [NBP1-85635] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Hep-G2](http://images.novusbio.com/fullsize/MBNL3-Antibody-Western-Blot-NBP1-85635-img0007.jpg "Western Blot: MBNL3 Antibody [NBP1-85635] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Hep-G2")
![Immunocytochemistry/Immunofluorescence: MBNL3 Antibody [NBP1-85635] - Staining of human cell line A-431 shows localization to the Golgi apparatus & vesicles. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/MBNL3-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85635-img0008.jpg "Immunocytochemistry/Immunofluorescence: MBNL3 Antibody [NBP1-85635] - Staining of human cell line A-431 shows localization to the Golgi apparatus & vesicles. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: MBNL3 Antibody [NBP1-85635] - Staining of human placenta shows high expression.](http://images.novusbio.com/fullsize/MBNL3-Antibody-Immunohistochemistry-Paraffin-NBP1-85635-img0006.jpg "Immunohistochemistry-Paraffin: MBNL3 Antibody [NBP1-85635] - Staining of human placenta shows high expression.")
![Immunohistochemistry-Paraffin: MBNL3 Antibody [NBP1-85635] - Staining of human prostate shows low expression as expected.](http://images.novusbio.com/fullsize/MBNL3-Antibody-Immunohistochemistry-Paraffin-NBP1-85635-img0010.jpg "Immunohistochemistry-Paraffin: MBNL3 Antibody [NBP1-85635] - Staining of human prostate shows low expression as expected.")
![Immunocytochemistry Cardiac Troponin T Antibody (200805) [Unconjugated] - (Cardiac)](https://images.novusbio.com/images2/Troponin_T_MAB1874_Immunocytochemistry_15884.jpg)
![Immunohistochemistry Cardiac Troponin T Antibody (200805) [Unconjugated] - (Cardiac)](https://images.novusbio.com/images2/Troponin_T_MAB1874_Immunohistochemistry_17796.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")