![Immunohistochemistry-Paraffin: MAGP-2/MFAP5 Antibody [NBP1-82803] - Staining in human smooth muscle and cerebral cortex tissues using anti-MFAP5 antibody. Corresponding MFAP5 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/MAGP-2-MFAP5-Antibody-Immunohistochemistry-Paraffin-NBP1-82803-img0007.jpg "Immunohistochemistry-Paraffin: MAGP-2/MFAP5 Antibody [NBP1-82803] - Staining in human smooth muscle and cerebral cortex tissues using anti-MFAP5 antibody. Corresponding MFAP5 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENV |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MFAP5 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-82803 | Applications | Species |
|---|---|---|
| Leung CS, Yeung TL, Yip KP et al. Calcium Dependent FAK/CREB/TNNC1 Signaling Mediates the Effect of Stromal MFAP5 on Ovarian Cancer Metastatic Potential. Nat Commun 2014-10-03 [PMID: 25277212] (IF/IHC, WB, Human) | IF/IHC, WB | Human |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MFAP5 |
![Western Blot: MAGP-2/MFAP5 Antibody [NBP1-82803] - Analysis in human cell line BEWO.](http://images.novusbio.com/fullsize/MAGP-2-MFAP5-Antibody-Western-Blot-NBP1-82803-img0009.jpg "Western Blot: MAGP-2/MFAP5 Antibody [NBP1-82803] - Analysis in human cell line BEWO.")
![Immunohistochemistry-Paraffin: MAGP-2/MFAP5 Antibody [NBP1-82803] - Staining of human cerebral cortex shows low expression as expected.](http://images.novusbio.com/fullsize/MAGP-2-MFAP5-Antibody-Immunohistochemistry-Paraffin-NBP1-82803-img0005.jpg "Immunohistochemistry-Paraffin: MAGP-2/MFAP5 Antibody [NBP1-82803] - Staining of human cerebral cortex shows low expression as expected.")
![Immunohistochemistry-Paraffin: MAGP-2/MFAP5 Antibody [NBP1-82803] - Staining of human smooth muscle shows high expression.](http://images.novusbio.com/fullsize/MAGP-2-MFAP5-Antibody-Immunohistochemistry-Paraffin-NBP1-82803-img0006.jpg "Immunohistochemistry-Paraffin: MAGP-2/MFAP5 Antibody [NBP1-82803] - Staining of human smooth muscle shows high expression.")
![Immunohistochemistry-Paraffin: MAGP-2/MFAP5 Antibody [NBP1-82803] - Staining of human rectum shows strong membranous positivity in cells in lamina propria.](http://images.novusbio.com/fullsize/antibody/nbp1-82803_rabbit-polyclonal-magp-2-mfap5-antibody-immunohistochemistry-paraffin-2211202383212..jpg "Immunohistochemistry-Paraffin: MAGP-2/MFAP5 Antibody [NBP1-82803] - Staining of human rectum shows strong membranous positivity in cells in lamina propria.")
![Immunohistochemistry-Paraffin: MAGP-2/MFAP5 Antibody [NBP1-82803] - Staining of human testis shows strong membranous positivity in cells in lamina propria.](http://images.novusbio.com/fullsize/antibody/nbp1-82803_rabbit-polyclonal-magp-2-mfap5-antibody-immunohistochemistry-paraffin-2211202383315..jpg "Immunohistochemistry-Paraffin: MAGP-2/MFAP5 Antibody [NBP1-82803] - Staining of human testis shows strong membranous positivity in cells in lamina propria.")
![Western Blot Decorin Antibody [Unconjugated]](https://images.novusbio.com/images2/Decorin_AF143_Western_Blot_17244.jpg)
![Simple Western Decorin Antibody [Unconjugated]](https://images.novusbio.com/images2/Decorin_AF143_Simple_Western_17469.jpg)
![Immunohistochemistry Decorin Antibody [Unconjugated]](https://images.novusbio.com/images2/Decorin_AF143_Immunohistochemistry_17623.jpg)
![SDS-PAGE EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236-EG_234.jpg)
![Bioactivity EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236EG_1570.jpg)
![Cell Culture EGF [Unconjugated]](https://images.novusbio.com/images/236-eg_recombinant-human-egf-protein-cf-bioactivity-25202394053.jpg)
![Western Blot Lumican Antibody [Unconjugated]](https://images.novusbio.com/images2/Lumican_AF2846_Western_Blot_17014.jpg)
![Immunohistochemistry Lumican Antibody [Unconjugated]](https://images.novusbio.com/images2/Lumican_AF2846_Immunohistochemistry_17809.jpg)
![Immunocytochemistry RUNX2/CBFA1 Antibody (232902) [Unconjugated]](https://images.novusbio.com/images2/RUNX2_MAB2006_Immunocytochemistry_13309.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")