![Western Blot: Tsukushi/TSK Antibody [NBP1-87959] - Analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1,. Remaining relative intensity is presented. Loading control: Anti-PPIB.](http://images.novusbio.com/fullsize/Tsukushi-TSK-Antibody-Western-Blot-NBP1-87959-img0013.jpg "Western Blot: Tsukushi/TSK Antibody [NBP1-87959] - Analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1,. Remaining relative intensity is presented. Loading control: Anti-PPIB.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DTAHLDLSSNRLEMVNESVLAGPGYTTLAGLDLSHNLLTSISPTAFSRLRYLESLDLSHNGLTALPAESFTSSPLSDVNLSHNQLREVSVSAFTTHSQGRALHVDLSHNLIHR |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TSKU |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TSKU |
![Immunocytochemistry/Immunofluorescence: Tsukushi/TSK Antibody [NBP1-87959] - Staining of human cell line A549 shows localization to nucleus. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Tsukushi-TSK-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87959-img0008.jpg "Immunocytochemistry/Immunofluorescence: Tsukushi/TSK Antibody [NBP1-87959] - Staining of human cell line A549 shows localization to nucleus. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: Tsukushi/TSK Antibody [NBP1-87959] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/Tsukushi-TSK-Antibody-Immunohistochemistry-Paraffin-NBP1-87959-img0012.jpg "Immunohistochemistry-Paraffin: Tsukushi/TSK Antibody [NBP1-87959] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.")
![Western Blot: Tsukushi/TSK Antibody [NBP1-87959] - Analysis in human cell line A-549.](http://images.novusbio.com/fullsize/Tsukushi-TSK-Antibody-Western-Blot-NBP1-87959-img0006.jpg "Western Blot: Tsukushi/TSK Antibody [NBP1-87959] - Analysis in human cell line A-549.")
![Western Blot: Tsukushi/TSK Antibody [NBP1-87959] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/Tsukushi-TSK-Antibody-Western-Blot-NBP1-87959-img0007.jpg "Western Blot: Tsukushi/TSK Antibody [NBP1-87959] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Immunohistochemistry-Paraffin: Tsukushi/TSK Antibody [NBP1-87959] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/Tsukushi-TSK-Antibody-Immunohistochemistry-Paraffin-NBP1-87959-img0009.jpg "Immunohistochemistry-Paraffin: Tsukushi/TSK Antibody [NBP1-87959] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: Tsukushi/TSK Antibody [NBP1-87959] - Staining of human prostate shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/Tsukushi-TSK-Antibody-Immunohistochemistry-Paraffin-NBP1-87959-img0010.jpg "Immunohistochemistry-Paraffin: Tsukushi/TSK Antibody [NBP1-87959] - Staining of human prostate shows moderate cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: Tsukushi/TSK Antibody [NBP1-87959] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize/Tsukushi-TSK-Antibody-Immunohistochemistry-Paraffin-NBP1-87959-img0011.jpg "Immunohistochemistry-Paraffin: Tsukushi/TSK Antibody [NBP1-87959] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.")
![Bioactivity IL-4 [Unconjugated]](https://images.novusbio.com/images/protein/6507-ilcf_recombinant-human-il-4-cho-expressed-protein-cf-bioactivity-272020133214.jpg)
![N/A Neutrophil Elastase/ELA2 [Biotin]](https://images.novusbio.com/images2/DATA_Neutrophil_Elastase_DY451705_ELISA_2461.jpg)
![Bioactivity IL-2 [Unconjugated]](https://images.novusbio.com/images/202-il_recombinant-human-il-2-protein-bioactivity-174202314946.jpg)
![Immunohistochemistry BTK [p Tyr223] Antibody - BSA Free](https://images.novusbio.com/images/BTK-[p-Tyr223]-Antibody-Immunohistochemistry-NBP1-78295-img0002.jpg)
![Western Blot BTK [p Tyr223] Antibody - BSA Free](https://images.novusbio.com/images/BTK-[p-Tyr223]-Antibody-Western-Blot-NBP1-78295-img0004.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")