![Immunohistochemistry-Paraffin: Fibulin 2 Antibody [NBP1-88115] - Analysis in human testis and liver tissues. Corresponding FBLN2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Fibulin-2-Antibody-Immunohistochemistry-Paraffin-NBP1-88115-img0009.jpg "Immunohistochemistry-Paraffin: Fibulin 2 Antibody [NBP1-88115] - Analysis in human testis and liver tissues. Corresponding FBLN2 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TLGSFHCYKALTCEPGYALKDGECEDVDECAMGTHTCQPGFLCQNTKGSFYCQARQRCMDGFLQDPEGNCVDINECTSLSEPCRPGFSCINTVGSYTCQRNPLICARGYHASDDGTKCVDVNE |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | FBLN2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | FBLN2 |
![Immunocytochemistry/Immunofluorescence: Fibulin 2 Antibody [NBP1-88115] - Staining of human cell line BJ shows localization to plasma membrane. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Fibulin-2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88115-img0004.jpg "Immunocytochemistry/Immunofluorescence: Fibulin 2 Antibody [NBP1-88115] - Staining of human cell line BJ shows localization to plasma membrane. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: Fibulin 2 Antibody [NBP1-88115] - Staining of human urinary bladder shows strong positivity in connective tissue.](http://images.novusbio.com/fullsize/Fibulin-2-Antibody-Immunohistochemistry-Paraffin-NBP1-88115-img0013.jpg "Immunohistochemistry-Paraffin: Fibulin 2 Antibody [NBP1-88115] - Staining of human urinary bladder shows strong positivity in connective tissue.")
![Immunohistochemistry-Paraffin: Fibulin 2 Antibody [NBP1-88115] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/Fibulin-2-Antibody-Immunohistochemistry-Paraffin-NBP1-88115-img0010.jpg "Immunohistochemistry-Paraffin: Fibulin 2 Antibody [NBP1-88115] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: Fibulin 2 Antibody [NBP1-88115] - Staining of human skin shows strong positivity in connective tissue.](http://images.novusbio.com/fullsize/Fibulin-2-Antibody-Immunohistochemistry-Paraffin-NBP1-88115-img0011.jpg "Immunohistochemistry-Paraffin: Fibulin 2 Antibody [NBP1-88115] - Staining of human skin shows strong positivity in connective tissue.")
![Immunohistochemistry-Paraffin: Fibulin 2 Antibody [NBP1-88115] - Staining of human testis shows strong membranous positivity in peritubular myoid cells.](http://images.novusbio.com/fullsize/Fibulin-2-Antibody-Immunohistochemistry-Paraffin-NBP1-88115-img0012.jpg "Immunohistochemistry-Paraffin: Fibulin 2 Antibody [NBP1-88115] - Staining of human testis shows strong membranous positivity in peritubular myoid cells.")
![Immunohistochemistry Nidogen-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Nidogen2_AF3385_Immunohistochemistry_21102.jpg)
![Immunocytochemistry Versican Antibody [Unconjugated] - Isoform V0](https://images.novusbio.com/images2/Versican_AF3054_Immunocytochemistry_6488.jpg)
![Immunocytochemistry Versican Antibody [Unconjugated] - Isoform V0](https://images.novusbio.com/images2/af3054_human-versican-affinity-purified-polyclonal-ab-immunocytochemistry-842022131824.jpg)
![Vitronectin [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Vitronectin [Unconjugated]")
![Western Blot SPARC Antibody [Unconjugated]](https://images.novusbio.com/images2/SPARC_AF942_Western_Blot_20730.jpg)
![Immunohistochemistry SPARC Antibody [Unconjugated]](https://images.novusbio.com/images2/SPARC_AF942_Immunohistochemistry_10419.jpg)
![Immunocytochemistry SPARC Antibody [Unconjugated]](https://images.novusbio.com/images2/SPARC_AF942_Immunocytochemistry__Immunofluorescence_23321.jpg)
![SDS-PAGE EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236-EG_234.jpg)
![Bioactivity EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236EG_1570.jpg)
![Cell Culture EGF [Unconjugated]](https://images.novusbio.com/images/236-eg_recombinant-human-egf-protein-cf-bioactivity-25202394053.jpg)
![N/A Endostatin [HRP]](https://images.novusbio.com/images2/DATA_Endostatin_DNST0_ELISA_778.jpg)
![N/A Endostatin [HRP]](https://images.novusbio.com/images2/Endostatin_DNST0_ELISA_152.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")