![Immunohistochemistry-Paraffin: Fibrillin 2 Antibody [NBP1-88169] - Staining in human placenta and prostate tissues using anti-FBN2 antibody. Corresponding FBN2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Fibrillin-2-Antibody-Immunohistochemistry-Paraffin-NBP1-88169-img0011.jpg "Immunohistochemistry-Paraffin: Fibrillin 2 Antibody [NBP1-88169] - Staining in human placenta and prostate tissues using anti-FBN2 antibody. Corresponding FBN2 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GMCFSGLVNGRCAQELPGRMTKMQCCCEPGRCWGIGTIPEACPVRGSEEYRRLCMDGLPMGGIPGSAGSRPGGTGGNGFAPSGNGNGYGPGGTGFIPIPGGNGFSPGVGGAGVGAGGQGPIITGLTILNQ |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | FBN2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Immunohistochemistry_6703.jpg)
![Western Blot ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Flow_Cytometry_20028.jpg)
![Simple Western ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Simple_Western_20109.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Fibrillin 2 Antibody (NBP1-88169)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | FBN2 |
![Western Blot: Fibrillin 2 Antibody [NBP1-88169] - Analysis in human cell lines U2OS and A-431. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-PARP1.](http://images.novusbio.com/fullsize/Fibrillin-2-Antibody-Western-Blot-NBP1-88169-img0007.jpg "Western Blot: Fibrillin 2 Antibody [NBP1-88169] - Analysis in human cell lines U2OS and A-431. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-PARP1.")
![Immunohistochemistry-Paraffin: Fibrillin 2 Antibody [NBP1-88169] - Staining of human placenta shows high expression.](http://images.novusbio.com/fullsize/Fibrillin-2-Antibody-Immunohistochemistry-Paraffin-NBP1-88169-img0009.jpg "Immunohistochemistry-Paraffin: Fibrillin 2 Antibody [NBP1-88169] - Staining of human placenta shows high expression.")
![Immunohistochemistry-Paraffin: Fibrillin 2 Antibody [NBP1-88169] - Staining of human prostate shows low expression as expected.](http://images.novusbio.com/fullsize/Fibrillin-2-Antibody-Immunohistochemistry-Paraffin-NBP1-88169-img0010.jpg "Immunohistochemistry-Paraffin: Fibrillin 2 Antibody [NBP1-88169] - Staining of human prostate shows low expression as expected.")
![Immunohistochemistry CEACAM7 Antibody [Unconjugated]](https://images.novusbio.com/images2/CEACAM7_AF4478_Immunohistochemistry_20616.jpg)
![Western Blot CEACAM7 Antibody [Unconjugated]](https://images.novusbio.com/images2/CEACAM-7_AF4478_Western_Blot_5475.jpg)
![N/A C-Reactive Protein/CRP [Biotin]](https://images.novusbio.com/images2/DATA_CReactive_Protein_DY1707_ELISA_1701.jpg)
![Immunohistochemistry CD55/DAF Antibody [Unconjugated]](https://images.novusbio.com/images2/CD55_AF2009_Immunohistochemistry_6728.jpg)
![Immunocytochemistry CD55/DAF Antibody [Unconjugated]](https://images.novusbio.com/images2/CD55_AF2009_Immunocytochemistry__Immunofluorescence_23052.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![SDS-PAGE EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236-EG_234.jpg)
![Bioactivity EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236EG_1570.jpg)
![Cell Culture EGF [Unconjugated]](https://images.novusbio.com/images/236-eg_recombinant-human-egf-protein-cf-bioactivity-25202394053.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")