![Western Blot: Mad Antibody [NBP2-85249] - Host: Mouse. Target Name: MXD1. Sample Tissue: Mouse Small Intestine. Antibody Dilution: 1ug/ml](http://images.novusbio.com/fullsize/Mad-Antibody-Western-Blot-NBP2-85249-img0002.jpg "Western Blot: Mad Antibody [NBP2-85249] - Host: Mouse. Target Name: MXD1. Sample Tissue: Mouse Small Intestine. Antibody Dilution: 1ug/ml")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 0.5 mg/ml |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of human Mad. Peptide sequence: MAAAVRMNIQMLLEAADYLERREREAEHGYASMLPYNNKDRDALKRRNKS The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MXD1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Mad Antibody (NBP2-85249)Find related products by research area.
|
|
The c-Myc Antibody: A Major Tool in Cancer Research C-Myc is a widely expressed transcription factor, regulating cellular differentiation, proliferation, cell cycle progression and pro-apoptotic gene expression. The c-Myc antibody is widely used in cancer research, as a number of human tumors have been... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MXD1 |
![Western Blot: Mad Antibody [NBP2-85249] - WB Suggested Anti-MXD1 Antibody Titration: 0.2-1 ug/ml. Positive Control: Human Muscle](http://images.novusbio.com/fullsize/Mad-Antibody-Western-Blot-NBP2-85249-img0001.jpg "Western Blot: Mad Antibody [NBP2-85249] - WB Suggested Anti-MXD1 Antibody Titration: 0.2-1 ug/ml. Positive Control: Human Muscle")
![Western Blot: Mad Antibody [NBP2-85249] - Host: Rabbit. Target: MXD1. Positive control (+): Mouse small intestine (M-IN). Negative control (-): Mouse testis (M-TE). Antibody concentration: 1ug/ml](http://images.novusbio.com/fullsize/Mad-Antibody-Western-Blot-NBP2-85249-img0003.jpg "Western Blot: Mad Antibody [NBP2-85249] - Host: Rabbit. Target: MXD1. Positive control (+): Mouse small intestine (M-IN). Negative control (-): Mouse testis (M-TE). Antibody concentration: 1ug/ml")
![Immunocytochemistry Mxi1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Mxi1_AF4185_Immunocytochemistry__Immunofluorescence_20286.jpg)
![Chromatin Immunoprecipitation (ChIP) Smad4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Smad4_AF2097_Chromatin_Immunoprecipitation_11225.jpg)
![Western Blot Smad4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Smad4_AF2097_Western_Blot_17168.jpg)
![Immunocytochemistry Smad4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Smad4_AF2097_Immunocytochemistry__Immunofluorescence_17807.jpg)
![Western Blot Smad2/3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Smad3_AF3797_Western_Blot_5347.jpg)
![Chromatin Immunoprecipitation (ChIP) Smad2/3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Smad3_AF3797_Chromatin_Immunoprecipitation_11240.jpg)
![Immunocytochemistry Smad2/3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Smad3_AF3797_Immunocytochemistry_11829.jpg)
![Immunohistochemistry Smad1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Smad1_AF2039_Immunohistochemistry_10106.jpg)
![Western Blot Smad1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Smad1_AF2039_Western_Blot_5162.jpg)
![Simple Western Smad1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Smad1_AF2039_Simple_Western_16677.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")