![Immunocytochemistry/Immunofluorescence: LLGL2 Antibody [NBP1-81753] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/LLGL2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-81753-img0004.jpg "Immunocytochemistry/Immunofluorescence: LLGL2 Antibody [NBP1-81753] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TKYGQGFYLISPSEFERFSLSTKWLVEPRCLVDSAETKNHRPGNGAGPKKAPSRARNSGTQSDGEEKQPGLVMERALLSDERVLKEIQSTLEGDRGSGNWRSHRAAVGCSLSNGGAE |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | LLGL2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Intracellular Staining by Flow Cytometry Galectin-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Galectin-1_AF1152_Flow_Cytometry_11328.jpg)
![Simple Western Galectin-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Galectin1_AF1152_Simple_Western_16673.jpg)
![Immunohistochemistry Galectin-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Galectin-1_AF1152_Immunohistochemistry_6684.jpg)
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_15885.jpg)
![Immunohistochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunohistochemistry_15886.jpg)
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_16572.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for LLGL2 Antibody (NBP1-81753)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | LLGL2 |
![Immunohistochemistry-Paraffin: LLGL2 Antibody [NBP1-81753] - Staining of human small intestine shows moderate to strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/LLGL2-Antibody-Immunohistochemistry-Paraffin-NBP1-81753-img0013.jpg "Immunohistochemistry-Paraffin: LLGL2 Antibody [NBP1-81753] - Staining of human small intestine shows moderate to strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: LLGL2 Antibody [NBP1-81753] - Staining of human fallopian tube shows moderate to strong cytoplasmic postivity in glandular cells.](http://images.novusbio.com/fullsize/LLGL2-Antibody-Immunohistochemistry-Paraffin-NBP1-81753-img0009.jpg "Immunohistochemistry-Paraffin: LLGL2 Antibody [NBP1-81753] - Staining of human fallopian tube shows moderate to strong cytoplasmic postivity in glandular cells.")
![Immunohistochemistry-Paraffin: LLGL2 Antibody [NBP1-81753] - Staining of human stomach shows weak to moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/LLGL2-Antibody-Immunohistochemistry-Paraffin-NBP1-81753-img0010.jpg "Immunohistochemistry-Paraffin: LLGL2 Antibody [NBP1-81753] - Staining of human stomach shows weak to moderate cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: LLGL2 Antibody [NBP1-81753] - Staining of human skeletal muscle shows very weak cytoplasmic positivity in myocytes as expected.](http://images.novusbio.com/fullsize/LLGL2-Antibody-Immunohistochemistry-Paraffin-NBP1-81753-img0012.jpg "Immunohistochemistry-Paraffin: LLGL2 Antibody [NBP1-81753] - Staining of human skeletal muscle shows very weak cytoplasmic positivity in myocytes as expected.")
![SDS-PAGE EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236-EG_234.jpg)
![Bioactivity EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236EG_1570.jpg)
![Cell Culture EGF [Unconjugated]](https://images.novusbio.com/images/236-eg_recombinant-human-egf-protein-cf-bioactivity-25202394053.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Immunocytochemistry Glucagon Antibody (181402) [Unconjugated]](https://images.novusbio.com/images2/Glucagon_MAB1249_Immunocytochemistry_6560.jpg)
![Intracellular Staining by Flow Cytometry Glucagon Antibody (181402) [Unconjugated]](https://images.novusbio.com/images2/Glucagon_MAB1249_Flow_Cytometry_20264.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")