![Immunocytochemistry/Immunofluorescence: Tomosyn Antibody [NBP2-56176] - Staining of human cell line U-2 OS shows localization to cytosol.](http://images.novusbio.com/fullsize/Tomosyn-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-56176-img0001.jpg "Immunocytochemistry/Immunofluorescence: Tomosyn Antibody [NBP2-56176] - Staining of human cell line U-2 OS shows localization to cytosol.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SAHVIIYRFSKQEVITEVIPMLEVRLLYEINDVETPEGEQPPPLPTPVGGSNPQPIPPQSHPSTSSSSSDGLRDN |
| Predicted Species | Mouse (95%), Rat (93%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | STXBP5 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. IHC, Retrieval method: HIER pH6. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Immunohistochemistry Epimorphin/Syntaxin 2 Antibody (338930) [Unconjugated]](https://images.novusbio.com/images2/Epimorphin_MAB2568_Immunohistochemistry_6977.jpg)
![Western Blot Syntaxin-BP1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Syntaxin-BP1_AF5675_Western_Blot_5803.jpg)
![Immunohistochemistry Syntaxin-BP1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Syntaxin-BP1_AF5675_Immunohistochemistry_7192.jpg)
![Knockout Validated Syntaxin-BP1 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af5675_human-mouse-rat-syntaxin-bp1-affinity-purified-polyclonal-ab-knockout-validated-2410202414339.png)
Secondary Antibodies |
Isotype Controls |
Research Areas for Tomosyn Antibody (NBP2-56176)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | STXBP5 |
![Immunohistochemistry-Paraffin: Tomosyn Antibody [NBP2-56176] - Staining in human parathyroid gland and liver tissues using anti-STXBP5 antibody. Corresponding STXBP5 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Tomosyn-Antibody-Immunohistochemistry-Paraffin-NBP2-56176-img0004.jpg "Immunohistochemistry-Paraffin: Tomosyn Antibody [NBP2-56176] - Staining in human parathyroid gland and liver tissues using anti-STXBP5 antibody. Corresponding STXBP5 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: Tomosyn Antibody [NBP2-56176] - Staining of human liver shows low expression as expected.](http://images.novusbio.com/fullsize/Tomosyn-Antibody-Immunohistochemistry-Paraffin-NBP2-56176-img0002.jpg "Immunohistochemistry-Paraffin: Tomosyn Antibody [NBP2-56176] - Staining of human liver shows low expression as expected.")
![Immunohistochemistry-Paraffin: Tomosyn Antibody [NBP2-56176] - Staining of human parathyroid gland shows high expression.](http://images.novusbio.com/fullsize/Tomosyn-Antibody-Immunohistochemistry-Paraffin-NBP2-56176-img0003.jpg "Immunohistochemistry-Paraffin: Tomosyn Antibody [NBP2-56176] - Staining of human parathyroid gland shows high expression.")
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Immunocytochemistry Synaptotagmin 1 Antibody (ASV48) [Unconjugated]](https://images.novusbio.com/images2/Synaptotagmin-1_MAB4364_Immunocytochemistry_11323.jpg)
![Immunohistochemistry Synaptotagmin 1 Antibody (ASV48) [Unconjugated]](https://images.novusbio.com/images2/Synaptotagmin-1_MAB4364_Immunohistochemistry_7025.jpg)
![Immunocytochemistry Synaptotagmin 1 Antibody (ASV48) [Unconjugated]](https://images.novusbio.com/images2/Synaptotagmin1_MAB4364_Immunocytochemistry_13008.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")