![Western Blot: LEF1 Antibody [NBP1-86960] - Analysis in human cell lines SK-MEL-30 and A-549 using anti-LEF1 antibody. Corresponding LEF1 RNA-seq data are presented for the same cell lines. Loading control: anti-PPIB.](http://images.novusbio.com/fullsize/LEF1-Antibody-Western-Blot-NBP1-86960-img0023.jpg "Western Blot: LEF1 Antibody [NBP1-86960] - Analysis in human cell lines SK-MEL-30 and A-549 using anti-LEF1 antibody. Corresponding LEF1 RNA-seq data are presented for the same cell lines. Loading control: anti-PPIB.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SDVNSKQGMSRHPPAPDIPTFYPLSPGGVGQITPPLGWQGQPVYPITGGFRQPYPSSLSVDTSMSRFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIKKPLNAFMLY |
| Predicted Species | Mouse (98%), Rat (96%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | LEF1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/beta-Catenin_AF1329_Western_Blot_5100.jpg)
![Chromatin Immunoprecipitation (ChIP) beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/beta-Catenin_AF1329_Chromatin_Immunoprecipitation_11251.jpg)
![Simple Western beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/betaCatenin_AF1329_Simple_Western_17134.jpg)
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_15885.jpg)
![Immunohistochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunohistochemistry_15886.jpg)
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_16572.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for LEF1 Antibody (NBP1-86960)Find related products by research area.
|
|
The role of Wnts in neuroinflammation By Michalina Hanzel, PhDThe multifaceted roles of the Wnt family of glycoproteins have been extensively characterized throughout embryonic development and adult homeostasis. The highly conserved, cell- and tissue- s... Read full blog post. |
|
Beta Catenin in Cell Adhesion and T-cell Signaling Beta Catenin is a cytosolic, 88 kDa intracellular protein that tightly associates with cell surface cadherin glycoproteins. It is one member of the catenin family that includes alpha Catenin, beta Catenin, and gamma Catenin. Colocalization studies usi... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | LEF1 |
![Western Blot: LEF1 Antibody [NBP1-86960] - Analysis in control (vector only transfected HEK293T lysate) and LEF1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/LEF1-Antibody-Western-Blot-NBP1-86960-img0025.jpg "Western Blot: LEF1 Antibody [NBP1-86960] - Analysis in control (vector only transfected HEK293T lysate) and LEF1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
![Immunocytochemistry/Immunofluorescence: LEF1 Antibody [NBP1-86960] - Staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/LEF1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-86960-img0024.jpg "Immunocytochemistry/Immunofluorescence: LEF1 Antibody [NBP1-86960] - Staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: LEF1 Antibody [NBP1-86960] - Staining of human oral mucosa shows moderate nuclear positivity in subset of squamous epithelial cells.](http://images.novusbio.com/fullsize/LEF1-Antibody-Immunohistochemistry-Paraffin-NBP1-86960-img0018.jpg "Immunohistochemistry-Paraffin: LEF1 Antibody [NBP1-86960] - Staining of human oral mucosa shows moderate nuclear positivity in subset of squamous epithelial cells.")
![Immunohistochemistry-Paraffin: LEF1 Antibody [NBP1-86960] - Staining of human lymph node shows moderate to strong nuclear positivity in non - germinal center cells.](http://images.novusbio.com/fullsize/LEF1-Antibody-Immunohistochemistry-Paraffin-NBP1-86960-img0017.jpg "Immunohistochemistry-Paraffin: LEF1 Antibody [NBP1-86960] - Staining of human lymph node shows moderate to strong nuclear positivity in non - germinal center cells.")
![Western Blot TCF7/TCF1 Antibody (812145) [Unconjugated]](https://images.novusbio.com/images2/TCF7_MAB8224_Western_Blot_14720.jpg)
![Intracellular Staining by Flow Cytometry TCF7/TCF1 Antibody (812145) [Unconjugated]](https://images.novusbio.com/images2/TCF7_MAB8224_Flow_Cytometry_14888.jpg)
![Bioactivity Wnt-3a [Unconjugated]](https://images.novusbio.com/images2/Wnt3a_5036WN_2880.jpg)
![Bioactivity Wnt-3a [Unconjugated]](https://images.novusbio.com/images2/5036-wn_recombinant-human-wnt-3a-protein-bioactivity-3112023115329.jpg)
![Cell Culture Wnt-3a [Unconjugated]](https://images.novusbio.com/images/5036-wn_recombinant-human-wnt-3a-protein-bioactivity-252023103514.jpg)
![Western Blot TCF-3/E2A Antibody (826927) [Unconjugated]](https://images.novusbio.com/images2/TCF3_MAB7650_Western_Blot_12841.jpg)
![Immunohistochemistry TCF-3/E2A Antibody (826927) [Unconjugated]](https://images.novusbio.com/images2/TCF3_MAB7650_Immunohistochemistry_12859.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")