Home » Kv12.1 » Kv12.1 Proteins » Kv12.1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Kv12.1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Kv12.1 Recombinant Protein Antigen (NBP3-17510PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

Kv12.1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Kv12.1

Source: E.coli

Amino Acid Sequence: RCISPHSDSTLTPLQSISATLSSSVCSSSETSLHLVLPSRSEEGSFSQGTVSSFSLENLPGSWNQEGMASASTKPLENLPLEVVTSTAEVKDNKA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KCNH8
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17510. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com For further blocking peptide related information and a protocol, click here.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Kv12.1 Recombinant Protein Antigen

  • ELK channel 3
  • ELK
  • ELK1
  • elk3
  • ether-a-go-go-like potassium channel 1
  • Ether-a-go-go-like potassium channel 3
  • hElk1
  • Kv12.1
  • potassium voltage-gated channel subfamily H member 8
  • potassium voltage-gated channel, subfamily H (eag-related), member 8
  • Voltage-gated potassium channel subunit Kv12.1

Background

Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from bothfunctional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heartrate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cellvolume. This gene encodes a member of the potassium channel, voltage-gated, subfamily H. This member is a pore-forming(alpha) subunit. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
ERK1 Antibody
(1E5) - BSA Free
NBP2-22203
Flow Cytometry ERK1 Antibody (1E5) - BSA Free
Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free
Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Elk-1 Antibody
NBP2-38278
Immunocytochemistry/ Immunofluorescence Elk-1 Antibody
Immunohistochemistry-Paraffin Elk-1 Antibody
Immunohistochemistry-Paraffin Elk-1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
c-Fos Antibody
(2H2)
NBP2-50037
Knockout Validated c-Fos Antibody (2H2)
Immunocytochemistry/ Immunofluorescence c-Fos Antibody (2H2)
Immunocytochemistry/ Immunofluorescence c-Fos Antibody (2H2)
(1 Review)
(18 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
EphB2 Antibody
[Unconjugated]
AF467
Simple Western EphB2 Antibody [Unconjugated]
Western Blot EphB2 Antibody [Unconjugated]
Immunocytochemistry EphB2 Antibody [Unconjugated]
(5 Reviews)
(62 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
PrPC Antibody
NB100-56605
Western Blot PrPC Antibody
Species: Av, Bv, Sh
Applications: WB
Serum Response
Factor SRF Antibody ( ...
NBP3-13785
Flow Cytometry Serum Response Factor SRF Antibody (PCRP-SRF-1F7)
Immunocytochemistry/ Immunofluorescence Serum Response Factor SRF Antibody (PCRP-SRF-1F7)
Immunohistochemistry-Paraffin Serum Response Factor SRF Antibody (PCRP-SRF-1F7)
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC-P, IP, PA, WB
c-jun [p Ser63]
Antibody (1018Y) [Unc ...
MAB8930
Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
EGR1 Antibody
[Unconjugated]
AF2818
EGR1 Antibody [Unconjugated]
(13 Publications)
Species: Hu
Applications: ICC, WB
SGSM3 Antibody
NBP2-13304
Immunohistochemistry-Paraffin SGSM3 Antibody
Immunocytochemistry/ Immunofluorescence SGSM3 Antibody
Western Blot SGSM3 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
p38 gamma/SAPK3
Antibody [Unconjugate
AF1347
Immunocytochemistry p38 gamma/SAPK3 Antibody [Unconjugated]
Simple Western p38 gamma/SAPK3 Antibody [Unconjugated]
Western Blot p38 gamma/SAPK3 Antibody [Unconjugated]
(8 Publications)
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
JNK1 Antibody
(228601) [Unconjugate
MAB17761
Western Blot JNK1 Antibody (228601) [Unconjugated]
Western Blot JNK1 Antibody (228601) [Unconjugated]
Immunocytochemistry JNK1 Antibody (228601) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC, WB
MEK1 Antibody
(OTI1F5)
NBP1-47833
Western Blot MEK1 Antibody (OTI1F5)
Immunohistochemistry-Paraffin MEK1 Antibody (OTI1F5)
Immunohistochemistry-Paraffin MEK1 Antibody (OTI1F5)
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
HUWE1 Antibody
NB100-652
Western Blot HUWE1 Antibody
Immunohistochemistry-Paraffin HUWE1 Antibody
Immunoprecipitation HUWE1 Antibody
(18 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
EGF [Unconjugated]
236-EG
SDS-PAGE EGF [Unconjugated]
Bioactivity EGF [Unconjugated]
Cell Culture EGF [Unconjugated]
(777 Publications)
Species: Hu
Applications: BA
ELK4 Antibody
NBP1-87092
Immunocytochemistry/ Immunofluorescence ELK4 Antibody
Western Blot ELK4 Antibody
Immunohistochemistry-Paraffin ELK4 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
p38 alpha Antibody
[Unconjugated]
AF8691
Simple Western p38 alpha Antibody [Unconjugated]
Western Blot p38 alpha Antibody [Unconjugated]
Immunohistochemistry p38 alpha Antibody [Unconjugated]
(1 Review)
(11 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
Kv12.1 Recombinant
Protein Antigen
NBP3-17510PEP
Kv12.1 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for Kv12.1 Recombinant Protein Antigen (NBP3-17510PEP) (0)

There are no publications for Kv12.1 Recombinant Protein Antigen (NBP3-17510PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kv12.1 Recombinant Protein Antigen (NBP3-17510PEP) (0)

There are no reviews for Kv12.1 Recombinant Protein Antigen (NBP3-17510PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Kv12.1 Recombinant Protein Antigen (NBP3-17510PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Kv12.1 Products

Array NBP3-17510PEP

Research Areas for Kv12.1 Recombinant Protein Antigen (NBP3-17510PEP)

Find related products by research area.

Blogs on Kv12.1

There are no specific blogs for Kv12.1, but you can read our latest blog posts.

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Kv12.1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol KCNH8