![Western Blot: Ku80/XRCC5 Antibody (3D8) [H00007520-M02] - XRCC5 monoclonal antibody (M02), clone 3D8. Analysis of XRCC5 expression in A-431.](http://images.novusbio.com/fullsize/Ku80-XRCC5-Antibody-3D8-Western-Blot-H00007520-M02-img0008.jpg "Western Blot: Ku80/XRCC5 Antibody (3D8) [H00007520-M02] - XRCC5 monoclonal antibody (M02), clone 3D8. Analysis of XRCC5 expression in A-431.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IHC, NULL |
| Clone | 3D8 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | XRCC5 (AAH19027.1, 1 a.a. ~ 732 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MVRSGNKAAVVLCMDVGFTMSNSIPGIESPFEQAKKVITMFVQRQVFAENKDEIALVLFGTDGTDNPLSGGDQYQNITVHRHLMLPDFDLLEDIESKIQPGSQQADSLDALIVSMDVIQHETIGKKFEKRHIEIFTDLSSRFSKSQLDIIIHSLKKCDISLQFFLPFSLGKEDGSGDRGDGPFRLGGHGPSFPLKGITEQQKEGLEIVKMVMISLEGEDGLDEIYSFSESLRKLCVFKKIERHSIHWPCRLTIGSNLSIRIAAYKSILQERVKKTWTVVDAKTLKKEDIQKETVYCLNDDDETEVLKEDIIQGFRYGSDIVPFSKVDEEQMKYKSEGKCFSVLGFCKSSQVQRRFFMGNQVLKVFAARDDEAAAVALSSLIHALDDLDMVAIVRYAYDKRANPQVGVAFPHIKHNYECLVYVQLPFMEDLRQYMFSSLKNSKKYAPTEAQLNAVDALIDSMSLAKKDEKTDTLEDLFPTTKIPNPRFQRLFQCLLHRALHPREPLPPIQQHIWNMLNPPAEVTTKSQIPLSKIKTLFPLIEAKKKDQVTAQEIFQDNHEDGPTAKKLKTEQGGAHFSVSSLAEGSVTSVGSVNPAENFRVLVKQKKASFEEASNQLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQRFNNFLKALQEKVEIKQLNHFWEIVVQDGIALITKEEASGSSVTAEEAKKFLAPKDKPSGDTAAVFEEGGDVDDLLDMI |
| Localization | Nuclear |
| Specificity | XRCC5 - X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining; Ku autoantigen, 80kDa) |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | XRCC5 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA and IHC-P. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
| Publications using H00007520-M02 | Applications | Species |
|---|---|---|
| Hasegawa T, Someya M, Hori M et al. Expression of Ku70 predicts results of radiotherapy in prostate cancer. Strahlenther Onkol 2016-07-27 [PMID: 27465041] | ||
| Hori M, Someya M, Matsumoto Y et al. Influence of XRCC4 expression in esophageal cancer cells on the response to radiotherapy. Med Mol Morphol 2016-06-23 [PMID: 27338590] | ||
| Nomura F, Sogawa K, Noda K et al. Serum anti-Ku86 is a potential biomarker for early detection of hepatitis C virus-related hepatocellular carcinoma. Biochem Biophys Res Commun. 2012-04-19 [PMID: 22554520] | ||
| Halbert D, Domenyuk V, Spetzler D et al. Aptamers and uses thereof United States Patent Application US 9958448 B2 2018-01-01 |
Secondary Antibodies |
Isotype Controls |
Research Areas for Ku80/XRCC5 Antibody (H00007520-M02)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: Ku80/XRCC5 Antibody (3D8) [H00007520-M02] - Analysis of monoclonal antibody to XRCC5 on HeLa cell . Antibody concentration 10 ug/ml.](http://images.novusbio.com/fullsize/Ku80-XRCC5-Antibody-3D8-Immunocytochemistry-Immunofluorescence-H00007520-M02-img0004.jpg "Immunocytochemistry/Immunofluorescence: Ku80/XRCC5 Antibody (3D8) [H00007520-M02] - Analysis of monoclonal antibody to XRCC5 on HeLa cell . Antibody concentration 10 ug/ml.")
![Immunohistochemistry-Paraffin: Ku80/XRCC5 Antibody (3D8) [H00007520-M02] - Analysis of monoclonal antibody to XRCC5 on formalin-fixed paraffin-embedded human pancreas. Antibody concentration 3 ug/ml.](http://images.novusbio.com/fullsize/Ku80-XRCC5-Antibody-3D8-Immunohistochemistry-Paraffin-H00007520-M02-img0006.jpg "Immunohistochemistry-Paraffin: Ku80/XRCC5 Antibody (3D8) [H00007520-M02] - Analysis of monoclonal antibody to XRCC5 on formalin-fixed paraffin-embedded human pancreas. Antibody concentration 3 ug/ml.")
![Western Blot: Ku80/XRCC5 Antibody (3D8) [H00007520-M02] - Analysis of XRCC5 expression in transfected 293T cell line by XRCC5 monoclonal antibody (M02), clone 3D8.Lane 1: XRCC5 transfected lysate(82.7 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/Ku80-XRCC5-Antibody-3D8-Western-Blot-H00007520-M02-img0009.jpg "Western Blot: Ku80/XRCC5 Antibody (3D8) [H00007520-M02] - Analysis of XRCC5 expression in transfected 293T cell line by XRCC5 monoclonal antibody (M02), clone 3D8.Lane 1: XRCC5 transfected lysate(82.7 KDa).Lane 2: Non-transfected lysate.")
![Sandwich ELISA: Ku80/XRCC5 Antibody (3D8) [H00007520-M02] - Detection limit for recombinant GST tagged XRCC5 is 0.3 ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/Ku80-XRCC5-Antibody-3D8-Sandwich-ELISA-H00007520-M02-img0007.jpg "Sandwich ELISA: Ku80/XRCC5 Antibody (3D8) [H00007520-M02] - Detection limit for recombinant GST tagged XRCC5 is 0.3 ng/ml as a capture antibody.")
![Western Blot Histone H2AX [p Ser139] Antibody [Unconjugated]](https://images.novusbio.com/images2/Histone_H2AX_AF2288_Western_Blot_5182.jpg)
![Simple Western Histone H2AX [p Ser139] Antibody [Unconjugated]](https://images.novusbio.com/images2/16395.jpg)
![Immunocytochemistry Histone H2AX [p Ser139] Antibody [Unconjugated]](https://images.novusbio.com/images2/Histone_H2AX_AF2288_Immunocytochemistry__Immunofluorescence_16920.jpg)
![Immunohistochemistry IL-1 RI Antibody [Unconjugated]](https://images.novusbio.com/images2/IL1_RI_AF771_Immunohistochemistry_22597.jpg)
![Neutralization IL-1 RI Antibody [Unconjugated]](https://images.novusbio.com/images2/IL-1_RI_AF771_Block_Neutralize_8962.jpg)
![Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.](https://images.novusbio.com/images/Mouse-IgG1-Kappa-Light-Chain-Isotype-Control-P3-6-2-8-1-Flow-Cytometry-NBP1-43319-img0002.jpg "Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.")