![Western Blot: JIK Antibody [NBP1-84988] - Analysis in control (vector only transfected HEK293T lysate) and TAOK3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/JIK-Antibody-Western-Blot-NBP1-84988-img0008.jpg "Western Blot: JIK Antibody [NBP1-84988] - Analysis in control (vector only transfected HEK293T lysate) and TAOK3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ESQEDEEDSEHGTSLNREMDSLGSNHSIPSMSVSTGSQSSSVNSMQEVMDESSSELVMMHDDESTINSSSSVVHKKDHVFIRDEAGHGDPRPEPRPTQSVQSQALHYRNR |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TAOK3 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for JIK Antibody (NBP1-84988)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TAOK3 |
![Immunohistochemistry-Paraffin: JIK Antibody [NBP1-84988] - Staining of human stomach shows strong cytoplasmic positivity in Parietal cells.](http://images.novusbio.com/fullsize/JIK-Antibody-Immunohistochemistry-Paraffin-NBP1-84988-img0002.jpg "Immunohistochemistry-Paraffin: JIK Antibody [NBP1-84988] - Staining of human stomach shows strong cytoplasmic positivity in Parietal cells.")
![Western Blot: JIK Antibody [NBP1-84988] - Analysis in human cell lines SK-MEL-30 and U2OS using Anti-TAOK3 antibody. Corresponding TAOK3 RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.](http://images.novusbio.com/fullsize/JIK-Antibody-Western-Blot-NBP1-84988-img0007.jpg "Western Blot: JIK Antibody [NBP1-84988] - Analysis in human cell lines SK-MEL-30 and U2OS using Anti-TAOK3 antibody. Corresponding TAOK3 RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.")
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![MSP/MST1 [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "MSP/MST1 [Unconjugated]")
![Western Blot JNK1 Antibody (228601) [Unconjugated]](https://images.novusbio.com/images2/JNK1_MAB17761_Western_Blot_5991.jpg)
![Western Blot JNK1 Antibody (228601) [Unconjugated]](https://images.novusbio.com/images2/JNK1_MAB17761_Western_Blot_6327.jpg)
![Immunocytochemistry JNK1 Antibody (228601) [Unconjugated]](https://images.novusbio.com/images2/JNK1_MAB17761_Immunocytochemistry__Immunofluorescence_20184.jpg)
![Simple Western p38 alpha Antibody [Unconjugated]](https://images.novusbio.com/images2/16324.jpg)
![Western Blot p38 alpha Antibody [Unconjugated]](https://images.novusbio.com/images2/p38_alpha_AF8691_Western_Blot_22371.jpg)
![Immunohistochemistry p38 alpha Antibody [Unconjugated]](https://images.novusbio.com/images2/p38_alpha_AF8691_Immunohistochemistry_7087.jpg)
![Immunohistochemistry FAK Antibody [Unconjugated]](https://images.novusbio.com/images2/FAK_AF4467_Immunohistochemistry_6835.jpg)
![Knockout Validated FAK Antibody [Unconjugated]](https://images.novusbio.com/images2/FAK_AF4467_Knockout_Validated_22783.jpg)
![Western Blot FAK Antibody [Unconjugated]](https://images.novusbio.com/images2/af4467_human-mouse-rat-fak-affinity-purified-polyclonal-ab-western-blot-116202015471.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")