![Immunohistochemistry-Paraffin: AGXT Antibody [NBP1-89200] - Analysis in human liver and pancreas tissues. Corresponding AGXT RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/AGXT-Antibody-Immunohistochemistry-Paraffin-NBP1-89200-img0018.jpg "Immunohistochemistry-Paraffin: AGXT Antibody [NBP1-89200] - Analysis in human liver and pancreas tissues. Corresponding AGXT RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, Simple Western, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: HPMTKDPGGHYTLQEVEEGLAQHKPVLLFLTHGESSTGVLQPLDGFGELCHRYKCLLLVDSVASLGGTPLYMDRQGIDILYSGS |
| Predicted Species | Rat (90%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | AGXT |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Immunohistochemistry_6703.jpg)
![Western Blot ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Flow_Cytometry_20028.jpg)
![Simple Western ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Simple_Western_20109.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for AGXT Antibody (NBP1-89200)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: AGXT Antibody [NBP1-89200] - Staining of human endometrium, fallopian tube, skin and testis using Anti-NEK1 antibody (A) NBP1-89200 shows similar protein distribution across tissues to independent antibody NBP2-34198 (B).](http://images.novusbio.com/fullsize/AGXT-Antibody-Immunohistochemistry-Paraffin-NBP1-89200-img0023.jpg "Immunohistochemistry-Paraffin: AGXT Antibody [NBP1-89200] - Staining of human endometrium, fallopian tube, skin and testis using Anti-NEK1 antibody (A) NBP1-89200 shows similar protein distribution across tissues to independent antibody NBP2-34198 (B).")
![Western Blot: AGXT Antibody [NBP1-89200] - Analysis in human liver tissue.](http://images.novusbio.com/fullsize/AGXT-Antibody-Western-Blot-NBP1-89200-img0024.jpg "Western Blot: AGXT Antibody [NBP1-89200] - Analysis in human liver tissue.")
![Immunohistochemistry-Paraffin: AGXT Antibody [NBP1-89200] - Staining of human endometrium shows no positivity in glandular cells as expected.](http://images.novusbio.com/fullsize/AGXT-Antibody-Immunohistochemistry-Paraffin-NBP1-89200-img0019.jpg "Immunohistochemistry-Paraffin: AGXT Antibody [NBP1-89200] - Staining of human endometrium shows no positivity in glandular cells as expected.")
![Immunohistochemistry-Paraffin: AGXT Antibody [NBP1-89200] - Staining of human liver shows strong granular positivity in cytoplasm in hepatocytes.](http://images.novusbio.com/fullsize/AGXT-Antibody-Immunohistochemistry-Paraffin-NBP1-89200-img0020.jpg "Immunohistochemistry-Paraffin: AGXT Antibody [NBP1-89200] - Staining of human liver shows strong granular positivity in cytoplasm in hepatocytes.")
![Immunohistochemistry-Paraffin: AGXT Antibody [NBP1-89200] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.](http://images.novusbio.com/fullsize/AGXT-Antibody-Immunohistochemistry-Paraffin-NBP1-89200-img0021.jpg "Immunohistochemistry-Paraffin: AGXT Antibody [NBP1-89200] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.")
![Immunohistochemistry-Paraffin: AGXT Antibody [NBP1-89200] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.](http://images.novusbio.com/fullsize/AGXT-Antibody-Immunohistochemistry-Paraffin-NBP1-89200-img0022.jpg "Immunohistochemistry-Paraffin: AGXT Antibody [NBP1-89200] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.")
![Simple Western: AGXT Antibody [NBP1-89200] - Simple Western lane view shows a specific band for AGXT in 0.2 mg/ml of Liver (left), HepG2 (right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://images.novusbio.com/fullsize/AGXT-Antibody-Simple-Western-NBP1-89200-img0007.jpg "Simple Western: AGXT Antibody [NBP1-89200] - Simple Western lane view shows a specific band for AGXT in 0.2 mg/ml of Liver (left), HepG2 (right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.")
![Simple Western: AGXT Antibody [NBP1-89200] - Electropherogram image(s) of corresponding Simple Western lane view. AGXT antibody was used at 1:20 dilution on Liver lysate(s).](http://images.novusbio.com/fullsize/AGXT-Antibody-Simple-Western-NBP1-89200-img0008.jpg "Simple Western: AGXT Antibody [NBP1-89200] - Electropherogram image(s) of corresponding Simple Western lane view. AGXT antibody was used at 1:20 dilution on Liver lysate(s).")
![Simple Western: AGXT Antibody [NBP1-89200] - Electropherogram image(s) of corresponding Simple Western Lane view. AGXT antibody was used at 1:20 dilution on HepG2 lysate(s).](http://images.novusbio.com/fullsize/AGXT-Antibody-Simple-Western-NBP1-89200-img0009.jpg "Simple Western: AGXT Antibody [NBP1-89200] - Electropherogram image(s) of corresponding Simple Western Lane view. AGXT antibody was used at 1:20 dilution on HepG2 lysate(s).")
![N/A IL-13 [Biotin]](https://images.novusbio.com/images2/DATA_IL13_DY413_ELISA_2010.jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![N/A Angiogenin [HRP]](https://images.novusbio.com/images2/Angiogenin_DAN00_ELISA_28.jpg)
![N/A Angiogenin [HRP]](https://images.novusbio.com/images2/DATA_Angiogenin_DAN00_ELISA_571.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")