![Western Blot: IGFBP-4 Antibody [NBP1-80549] - Host: Mouse. Target Name: IGFBP4. Sample Tissue: Mouse Brain. Antibody Dilution: 1ug/ml](http://images.novusbio.com/fullsize/IGFBP-4-Antibody-Western-Blot-NBP1-80549-img0007.jpg "Western Blot: IGFBP-4 Antibody [NBP1-80549] - Host: Mouse. Target Name: IGFBP4. Sample Tissue: Mouse Brain. Antibody Dilution: 1ug/ml")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 0.5 mg/ml |
| Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen | Synthetic peptide directed towards the middle region of human IGFBP4. Peptide sequence RALERLAASQSRTHEDLYIIPIPNCDRNGNFHPKQCHPALDGQRGKCWCV. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | IGFBP4 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Use in Immunohistochemistry-Frozen reported in scientific literature (PMID: 26305333). |
|
| Theoretical MW | 28 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Reviewed Applications |
|
|
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
![Western Blot IGF-I R/IGF1R Antibody (33255) [Unconjugated]](https://images.novusbio.com/images2/IGF-I_R_MAB391_Western_Blot_6136.jpg)
![Immunohistochemistry IGF-I R/IGF1R Antibody (33255) [Unconjugated]](https://images.novusbio.com/images2/IGFI_R_MAB391_Immunohistochemistry_21743.jpg)
![Flow Cytometry IGF-I R/IGF1R Antibody (33255) [Unconjugated]](https://images.novusbio.com/images2/IGFI_R_MAB391_Flow_Cytometry_22536.jpg)
![Immunohistochemistry PTH Antibody (918462) [Unconjugated]](https://images.novusbio.com/images2/PTH_MAB7665_Immunohistochemistry_16650.jpg)
![Western Blot PTH Antibody (918462) [Unconjugated]](https://images.novusbio.com/images2/PTH_MAB7665_Western_Blot_16656.jpg)
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Verified Customer |
Immunocytochemistry/Immunofluorescence | Mouse | 11/16/2016 |
Summary
|
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
| Verified Customer 11/16/2016 |
||
| Application: | Immunocytochemistry/Immunofluorescence | |
| Species: | Mouse |
![Immunocytochemistry/Immunofluorescence: IGFBP-4 Antibody [NBP1-80549] - Rac1 regulates vesicular exocytosis in decidual cells by controlling Rab27b. Secretions by decidual cells are reduced in the conditioned media of Rac1-null stromal cells. Stromal cells isolated from Rac1f/f and Rac1d/d uteri on day 4 of pregnancy were cultured for 96 hours, fixed and subjected to IF using IGFBP4 (Left) antibody. Conditioned media from cultured stromal cells isolated from Rac1f/f and Rac1d/d uteri were analyzed for IGFBP4 (Right) by ELISA. Data represent mean +/- SEM from three separate samples and were analyzed by two-way ANOVA with Bonferroni post-test. Asterisks indicate statistically significant differences (*P < 0.05, **P < 0.01, and ***P < 0.001). Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pgen.1005458), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/IGFBP-4-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-80549-img0006.jpg "Immunocytochemistry/Immunofluorescence: IGFBP-4 Antibody [NBP1-80549] - Rac1 regulates vesicular exocytosis in decidual cells by controlling Rab27b. Secretions by decidual cells are reduced in the conditioned media of Rac1-null stromal cells. Stromal cells isolated from Rac1f/f and Rac1d/d uteri on day 4 of pregnancy were cultured for 96 hours, fixed and subjected to IF using IGFBP4 (Left) antibody. Conditioned media from cultured stromal cells isolated from Rac1f/f and Rac1d/d uteri were analyzed for IGFBP4 (Right) by ELISA. Data represent mean +/- SEM from three separate samples and were analyzed by two-way ANOVA with Bonferroni post-test. Asterisks indicate statistically significant differences (*P < 0.05, **P < 0.01, and ***P < 0.001). Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pgen.1005458), licensed under a CC-BY license.")
![Immunohistochemistry-Paraffin: IGFBP-4 Antibody [NBP1-80549] - Human Prostate Tissue, 5.0ug/ml.](http://images.novusbio.com/fullsize/IGFBP-4-Antibody-Immunohistochemistry-Paraffin-NBP1-80549-img0003.jpg "Immunohistochemistry-Paraffin: IGFBP-4 Antibody [NBP1-80549] - Human Prostate Tissue, 5.0ug/ml.")
![Western Blot: IGFBP-4 Antibody [NBP1-80549] - Human Fetal Brain Lysate, concentration 1 ug/ml.](http://images.novusbio.com/fullsize/IGFBP-4-Antibody-Western-Blot-NBP1-80549-img0004.jpg "Western Blot: IGFBP-4 Antibody [NBP1-80549] - Human Fetal Brain Lysate, concentration 1 ug/ml.")
![Western Blot: IGFBP-4 Antibody [NBP1-80549] - Host: Rabbit. Target Name: IGFBP4. Sample Tissue: Human MDA-MB-435s Whole Cell. Antibody Dilution: 1ug/ml](http://images.novusbio.com/fullsize/IGFBP-4-Antibody-Western-Blot-NBP1-80549-img0008.jpg "Western Blot: IGFBP-4 Antibody [NBP1-80549] - Host: Rabbit. Target Name: IGFBP4. Sample Tissue: Human MDA-MB-435s Whole Cell. Antibody Dilution: 1ug/ml")
![Immunocytochemistry/Immunofluorescence: IGFBP-4 Antibody [NBP1-80549] - Mouse uterus stained with at a dilution of 1:1000. HIER is applied using citrate buffer pH6. Image from verified customer review.](http://images.novusbio.com/fullsize/IGFBP-4-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-80549-img0005.jpg "Immunocytochemistry/Immunofluorescence: IGFBP-4 Antibody [NBP1-80549] - Mouse uterus stained with at a dilution of 1:1000. HIER is applied using citrate buffer pH6. Image from verified customer review.")
![SDS-PAGE IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_40.jpg)
![Bioactivity IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_41.jpg)
![Mass Spectrometry IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_42.jpg)
![N/A IGFBP-3 [HRP]](https://images.novusbio.com/images2/DATA_IGFBP3_DGB300_ELISA_694.jpg)
![N/A IGFBP-3 [HRP]](https://images.novusbio.com/images2/IGFBP-3_DGB300_ELISA_104.jpg)
![SDS-PAGE IGF-II/IGF2 [Unconjugated]](https://images.novusbio.com/images2/IGF-II_292-G2_668.jpg)
![Bioactivity IGF-II/IGF2 [Unconjugated]](https://images.novusbio.com/images2/IGF-II_292-G2_669.jpg)
![Western Blot IGFBP-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/IGFBP2_AF674_Western_Blot_20670.jpg)
![Simple Western IGFBP-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/IGFBP2_AF674_Simple_Western_20942.jpg)
![Neutralization IGFBP-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/IGFBP-2_AF674_Block_Neutralize_8943.jpg)
![N/A IGFBP-1 [Biotin]](https://images.novusbio.com/images2/DATA_IGFBP1_DY871_ELISA_2250.jpg)
![Western Blot Pappalysin-1/PAPP-A Antibody [Unconjugated]](https://images.novusbio.com/images2/Pappalysin1_AF2487_Western_Blot_20190.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot Growth Hormone Antibody [Unconjugated]](https://images.novusbio.com/images2/Growth_Hormone_AF1067_Western_Blot_20961.jpg)
![ELISA Growth Hormone Antibody [Unconjugated]](https://images.novusbio.com/images2/Growth_Hormone_AF1067_ELISA_22201.jpg)
![Neutralization Growth Hormone Antibody [Unconjugated]](https://images.novusbio.com/images2/Growth_Hormone_AF1067_Block_Neutralize_8751.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![SDS-PAGE EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236-EG_234.jpg)
![Bioactivity EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236EG_1570.jpg)
![Cell Culture EGF [Unconjugated]](https://images.novusbio.com/images/236-eg_recombinant-human-egf-protein-cf-bioactivity-25202394053.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
