![Immunohistochemistry-Paraffin: IA-2/PTPRN Antibody [NBP1-83128] - Staining of human skeletal muscle shows low expression as expected.](http://images.novusbio.com/fullsize/IA-2-PTPRN-Antibody-Immunohistochemistry-Paraffin-NBP1-83128-img0007.jpg "Immunohistochemistry-Paraffin: IA-2/PTPRN Antibody [NBP1-83128] - Staining of human skeletal muscle shows low expression as expected.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: HSYGDLPGPSPAQLFQDSGLLYLAQELPAPSRARVPRLPEQGSSSRAEDSPEGYEKEGLGDRGEKPASPAVQPDAALQRLAAVLAGYGVELRQLTPEQLSTLLTLLQLLPKGA |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PTPRN |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry ZnT-8/SLC30A8 Antibody (815039) [Unconjugated]](https://images.novusbio.com/images2/ZnT8_MAB7936_Immunohistochemistry_12988.jpg)
![Intracellular Staining by Flow Cytometry ZnT-8/SLC30A8 Antibody (815039) [Unconjugated]](https://images.novusbio.com/images2/ZnT8_MAB7936_Flow_Cytometry_23901.jpg)
| Publication using NBP1-83128 | Applications | Species |
|---|---|---|
| Lindskog C, Korsgren O, Ponten F et al. Novel pancreatic beta cell-specific proteins: antibody-based proteomics for identification of new biomarker candidates. J Proteomics 2012-05-17 [PMID: 22465717] |
Secondary Antibodies |
Isotype Controls |
Research Areas for IA-2/PTPRN Antibody (NBP1-83128)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PTPRN |
![Immunohistochemistry: IA-2/PTPRN Antibody [NBP1-83128] - Staining of human adrenal gland shows high expression.](http://images.novusbio.com/fullsize/IA-2-PTPRN-Antibody-Immunohistochemistry-NBP1-83128-img0005.jpg "Immunohistochemistry: IA-2/PTPRN Antibody [NBP1-83128] - Staining of human adrenal gland shows high expression.")
![Immunohistochemistry-Paraffin: IA-2/PTPRN Antibody [NBP1-83128] - Staining of human adrenal gland shows strong cytoplasmic positivity in medullary cells.](http://images.novusbio.com/fullsize/IA-2-PTPRN-Antibody-Immunohistochemistry-Paraffin-NBP1-83128-img0006.jpg "Immunohistochemistry-Paraffin: IA-2/PTPRN Antibody [NBP1-83128] - Staining of human adrenal gland shows strong cytoplasmic positivity in medullary cells.")
![Immunohistochemistry-Paraffin: IA-2/PTPRN Antibody [NBP1-83128] - Staining in human adrenal gland and skeletal muscle tissues using anti-PTPRN antibody. Corresponding PTPRN RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/IA-2-PTPRN-Antibody-Immunohistochemistry-Paraffin-NBP1-83128-img0008.jpg "Immunohistochemistry-Paraffin: IA-2/PTPRN Antibody [NBP1-83128] - Staining in human adrenal gland and skeletal muscle tissues using anti-PTPRN antibody. Corresponding PTPRN RNA-seq data are presented for the same tissues.")
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Immunohistochemistry GAD2/GAD65 Antibody [Unconjugated]](https://images.novusbio.com/images2/GAD2_AF2247_Immunohistochemistry_20053.jpg)
![Immunohistochemistry GAD1/GAD67 Antibody [Unconjugated]](https://images.novusbio.com/images2/GAD1_AF2086_Immunohistochemistry_6730.jpg)
![Western Blot GAD1/GAD67 Antibody [Unconjugated]](https://images.novusbio.com/images2/GAD1_AF2086_Western_Blot_19950.jpg)
![Simple Western GAD1/GAD67 Antibody [Unconjugated]](https://images.novusbio.com/images2/GAD1_AF2086_Simple_Western_20168.jpg)
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")