![Immunohistochemistry-Paraffin: HSD17B12 Antibody [NBP1-81567] - Staining of human colon shows moderate to strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/HSD17B12-Antibody-Immunohistochemistry-Paraffin-NBP1-81567-img0012.jpg "Immunohistochemistry-Paraffin: HSD17B12 Antibody [NBP1-81567] - Staining of human colon shows moderate to strong cytoplasmic positivity in glandular cells.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: WGVGNEAGVGPGLGEWAVVTGSTDGIGKSYAEELAKHGMKVVLISRSKDKLDQVSSEIKEKFKVETRTIAVDFASEDIYDKIKTGLAGLEIGILVNNVGMSYEYPEYFLDVPDLD |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | HSD17B12 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot 17 beta-HSD1/HSD17B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/17_beta-HSD1_AF7178_Western_Blot_11632.jpg)
![Immunohistochemistry 17 beta-HSD1/HSD17B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/17_betaHSD1_AF7178_Immunohistochemistry_22701.jpg)
![Simple Western 17 beta-HSD1/HSD17B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/af7178_human-17-beta-hsd1-hsd17b1-affinity-purified-polyclonal-ab-simple-western-1342022125637.jpg)
![Immunocytochemistry NETO1 Antibody [Unconjugated]](https://images.novusbio.com/images2/NETO1_AF4337_Immunocytochemistry__Immunofluorescence_19534.jpg)
![Immunohistochemistry NETO1 Antibody [Unconjugated]](https://images.novusbio.com/images2/NETO1_AF4337_Immunohistochemistry_19699.jpg)
| Publication using NBP1-81567 | Applications | Species |
|---|---|---|
| Mohamed B, Mazeaud C, Baril M et Al. Very-long-chain fatty acid metabolic capacity of 17-beta-hydroxysteroid dehydrogenase type 12 (HSD17B12) promotes replication of hepatitis C virus and related flaviviruses Sci Rep 2020-03-04 [PMID: 32132633] (ICC/IF, WB, Human) | ICC/IF, WB | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for HSD17B12 Antibody (NBP1-81567)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | HSD17B12 |
![Immunohistochemistry-Paraffin: HSD17B12 Antibody [NBP1-81567] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/HSD17B12-Antibody-Immunohistochemistry-Paraffin-NBP1-81567-img0009.jpg "Immunohistochemistry-Paraffin: HSD17B12 Antibody [NBP1-81567] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Immunohistochemistry-Paraffin: HSD17B12 Antibody [NBP1-81567] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.](http://images.novusbio.com/fullsize/HSD17B12-Antibody-Immunohistochemistry-Paraffin-NBP1-81567-img0010.jpg "Immunohistochemistry-Paraffin: HSD17B12 Antibody [NBP1-81567] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.")
![Immunohistochemistry-Paraffin: HSD17B12 Antibody [NBP1-81567] - Staining of human lung shows strong cytoplasmic positivity in macrophages.](http://images.novusbio.com/fullsize/HSD17B12-Antibody-Immunohistochemistry-Paraffin-NBP1-81567-img0011.jpg "Immunohistochemistry-Paraffin: HSD17B12 Antibody [NBP1-81567] - Staining of human lung shows strong cytoplasmic positivity in macrophages.")
![Flow Cytometry KIR2DL3/CD158b2 Antibody (180701) [Unconjugated]](https://images.novusbio.com/images2/KIR2DL3_MAB2014_Flow_Cytometry_23697.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")