![Western Blot: HIV-1 Rev binding protein Antibody [NBP3-03420] - Analysis of extracts of various cell lines, using HIV-1 Rev binding protein antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: % nonfat dry milk in TBST.](http://images.novusbio.com/fullsize/HIV-1-Rev-binding-protein-Antibody-Western-Blot-NBP3-03420-img0005.jpg "Western Blot: HIV-1 Rev binding protein Antibody [NBP3-03420] - Analysis of extracts of various cell lines, using HIV-1 Rev binding protein antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: % nonfat dry milk in TBST.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human AGFG1 (NP_004495.2). MAASAKRKQEEKHLKMLRDMTGLPHNRKCFDCDQRGPTYVNMTVGSFVCTSCSGSLRGLNPPHRVKSISMTTFTQQEIEFLQKHGNEVCKQIWLGLFDDRSSAIPDFRDPQKVKEFLQEKYEKKRWYVPPEQAKVVASVHASISGSSASSTSSTPEVKPLKSLLGDSAPTLHLNKGTPSQSPVVGRSQGQQQEKKQFDLLSDLGSDIFAAPAPQSTATANFANFAHFNSHAAQNSANADFANFDAFGQSSGSSNFGGFPTASHSPFQPQTTGGSAASVNA |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | AGFG1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS with 50% glycerol, pH7.3. |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Western Blot FADD [p Ser194] Antibody (709736)](https://images.novusbio.com/images2/FADD_MAB7047_Western_Blot_11404.jpg)
![Immunocytochemistry FADD [p Ser194] Antibody (709736)](https://images.novusbio.com/images2/FADD_MAB7047_Immunocytochemistry_11450.jpg)
![Western Blot TRADD Antibody [Unconjugated]](https://images.novusbio.com/images2/TRADD_AF2658_Western_Blot_5202.jpg)
![Immunocytochemistry TRADD Antibody [Unconjugated]](https://images.novusbio.com/images2/TRADD_AF2658_Immunocytochemistry__Immunofluorescence_22493.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for HIV-1 Rev binding protein Antibody (NBP3-03420)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | AGFG1 |
![Immunocytochemistry/Immunofluorescence: HIV-1 Rev binding protein Antibody [NBP3-03420] - Analysis of HeLa cells using HIV-1 Rev binding protein antibody . Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/HIV-1-Rev-binding-protein-Antibody-Immunocytochemistry-Immunofluorescence-NBP3-03420-img0004.jpg "Immunocytochemistry/Immunofluorescence: HIV-1 Rev binding protein Antibody [NBP3-03420] - Analysis of HeLa cells using HIV-1 Rev binding protein antibody . Blue: DAPI for nuclear staining.")
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![N/A TNF RI/TNFRSF1A [HRP]](https://images.novusbio.com/images2/DATA_TNF_RI_DRT100_ELISA_815.jpg)
![N/A TNF RI/TNFRSF1A [HRP]](https://images.novusbio.com/images2/DATA_TNF_RI_DRT100_ELISA_816.jpg)
![N/A TNF RI/TNFRSF1A [HRP]](https://images.novusbio.com/images2/TNF_RI_DRT100_ELISA_175.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")