![Western Blot: Hemogen Antibody [NBP1-84907] - Analysis in control (vector only transfected HEK293T lysate) and HEMGN over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/Hemogen-Antibody-Western-Blot-NBP1-84907-img0010.jpg "Western Blot: Hemogen Antibody [NBP1-84907] - Analysis in control (vector only transfected HEK293T lysate) and HEMGN over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GKDQSHLKHHQTPDPHQEENHSPEVIGTWSLRNRELLRKRKAEVHEKETSQWLFGEQKKRKQQRTGKGNRRGRKRQQNTELKVEPQPQIEKEIVEKALAPI |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | HEMGN |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western ACE-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE2_AF933_Simple_Western_18669.jpg)
![Immunohistochemistry ACE-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE-2_AF933_Immunohistochemistry_9800.jpg)
![Immunohistochemistry ACE-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE-2_AF933_Immunohistochemistry_10025.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | HEMGN |
![Immunohistochemistry-Paraffin: Hemogen Antibody [NBP1-84907] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/Hemogen-Antibody-Immunohistochemistry-Paraffin-NBP1-84907-img0019.jpg "Immunohistochemistry-Paraffin: Hemogen Antibody [NBP1-84907] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: Hemogen Antibody [NBP1-84907] - Staining of human bone marrow shows high expression.](http://images.novusbio.com/fullsize/Hemogen-Antibody-Immunohistochemistry-Paraffin-NBP1-84907-img0007.jpg "Immunohistochemistry-Paraffin: Hemogen Antibody [NBP1-84907] - Staining of human bone marrow shows high expression.")
![Immunohistochemistry-Paraffin: Hemogen Antibody [NBP1-84907] - Analysis in human bone marrow and cerebral cortex tissues. Corresponding HEMGN RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Hemogen-Antibody-Immunohistochemistry-Paraffin-NBP1-84907-img0015.jpg "Immunohistochemistry-Paraffin: Hemogen Antibody [NBP1-84907] - Analysis in human bone marrow and cerebral cortex tissues. Corresponding HEMGN RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: Hemogen Antibody [NBP1-84907] - Staining of human cerebral cortex shows no positivity in neurons as expected.](http://images.novusbio.com/fullsize/Hemogen-Antibody-Immunohistochemistry-Paraffin-NBP1-84907-img0016.jpg "Immunohistochemistry-Paraffin: Hemogen Antibody [NBP1-84907] - Staining of human cerebral cortex shows no positivity in neurons as expected.")
![Immunohistochemistry-Paraffin: Hemogen Antibody [NBP1-84907] - Staining of human colon shows no positivity in glandular cells as expected.](http://images.novusbio.com/fullsize/Hemogen-Antibody-Immunohistochemistry-Paraffin-NBP1-84907-img0017.jpg "Immunohistochemistry-Paraffin: Hemogen Antibody [NBP1-84907] - Staining of human colon shows no positivity in glandular cells as expected.")
![Immunohistochemistry-Paraffin: Hemogen Antibody [NBP1-84907] - Staining of human kidney shows no positivity in cells in tubules.](http://images.novusbio.com/fullsize/Hemogen-Antibody-Immunohistochemistry-Paraffin-NBP1-84907-img0018.jpg "Immunohistochemistry-Paraffin: Hemogen Antibody [NBP1-84907] - Staining of human kidney shows no positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: Hemogen Antibody [NBP1-84907] - Staining of human bone marrow, colon, kidney and testis using Anti-HEMGN antibody (A) NBP1-84907 shows similar protein distribution across tissues to independent antibody NBP1-84909 (B).](http://images.novusbio.com/fullsize/Hemogen-Antibody-Immunohistochemistry-Paraffin-NBP1-84907-img0020.jpg "Immunohistochemistry-Paraffin: Hemogen Antibody [NBP1-84907] - Staining of human bone marrow, colon, kidney and testis using Anti-HEMGN antibody (A) NBP1-84907 shows similar protein distribution across tissues to independent antibody NBP1-84909 (B).")
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![MSP/MST1 [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "MSP/MST1 [Unconjugated]")
![SDS-PAGE IL-3 [Unconjugated]](https://images.novusbio.com/images2/IL-3_203-IL_345.jpg)
![Bioactivity IL-3 [Unconjugated]](https://images.novusbio.com/images2/IL-3_203-IL_347.jpg)
![SEC-MALS IL-3 [Unconjugated]](https://images.novusbio.com/images/203-il_recombinant-human-il-3-protein-sec-mals-133202482656..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")