![Immunohistochemistry-Paraffin: GIF Antibody [NBP1-81610] - Analysis in human stomach and skin tissues. Corresponding GIF RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/GIF-Antibody-Immunohistochemistry-Paraffin-NBP1-81610-img0008.jpg "Immunohistochemistry-Paraffin: GIF Antibody [NBP1-81610] - Analysis in human stomach and skin tissues. Corresponding GIF RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LFGQVLKDIVEKISMKIKDNGIIGDIYSTGLAMQALSVTPEPSKKEWNCKKTTDMILNEIKQGKFHNPMSIAQILPSLKGKTYLDVPQVTCSPDHEVQPTLPSNP |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CBLIF |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![PGA5 [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "PGA5 [Unconjugated]")
| Publication using NBP1-81610 | Applications | Species |
|---|---|---|
| Sayols S, Klassek J, Werner C et al. Signalling codes for the maintenance and lineage commitment of embryonic gastric epithelial progenitors Development 2020-01-28 [PMID: 32878924] (Immunohistochemistry, Immunohistochemistry-Frozen) | Immunohistochemistry, Immunohistochemistry-Frozen |
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Feng Li |
ICC | Mouse and mouse stomach | 05/16/2017 |
Summary
|
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
| Feng Li 05/16/2017 |
||
| Application: | ICC | |
| Species: | Mouse and mouse stomach |
| Gene Symbol | CBLIF |
![Western Blot: GIF Antibody [NBP1-81610] - Analysis in control (vector only transfected HEK293T lysate) and GIF over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/GIF-Antibody-Western-Blot-NBP1-81610-img0007.jpg "Western Blot: GIF Antibody [NBP1-81610] - Analysis in control (vector only transfected HEK293T lysate) and GIF over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
![Immunohistochemistry-Paraffin: GIF Antibody [NBP1-81610] - Staining of human stomach shows strong cytoplasmic positivity in Parietal cells.](http://images.novusbio.com/fullsize/GIF-Antibody-Immunohistochemistry-Paraffin-NBP1-81610-img0011.jpg "Immunohistochemistry-Paraffin: GIF Antibody [NBP1-81610] - Staining of human stomach shows strong cytoplasmic positivity in Parietal cells.")
![Immunohistochemistry-Paraffin: GIF Antibody [NBP1-81610] - Staining of human skin shows no positivity in squamous epithelial cells as expected.](http://images.novusbio.com/fullsize/GIF-Antibody-Immunohistochemistry-Paraffin-NBP1-81610-img0009.jpg "Immunohistochemistry-Paraffin: GIF Antibody [NBP1-81610] - Staining of human skin shows no positivity in squamous epithelial cells as expected.")
![Immunohistochemistry-Paraffin: GIF Antibody [NBP1-81610] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/GIF-Antibody-Immunohistochemistry-Paraffin-NBP1-81610-img0010.jpg "Immunohistochemistry-Paraffin: GIF Antibody [NBP1-81610] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: GIF Antibody [NBP1-81610] - Staining of human kidney shows no positivity in cells in tubules as expected.](http://images.novusbio.com/fullsize/GIF-Antibody-Immunohistochemistry-Paraffin-NBP1-81610-img0012.jpg "Immunohistochemistry-Paraffin: GIF Antibody [NBP1-81610] - Staining of human kidney shows no positivity in cells in tubules as expected.")
![Immunohistochemistry Cubilin Antibody [Unconjugated]](https://images.novusbio.com/images2/Cubilin_AF3700_Immunohistochemistry_24138.jpg)
![Western Blot Cubilin Antibody [Unconjugated]](https://images.novusbio.com/images2/Cubilin_AF3700_Western_Blot_20441.jpg)
![Simple Western Cubilin Antibody [Unconjugated]](https://images.novusbio.com/images2/Cubilin_AF3700_Simple_Western_20573.jpg)
![Bioactivity IL-2 [Unconjugated]](https://images.novusbio.com/images/202-il_recombinant-human-il-2-protein-bioactivity-174202314946.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![Bioactivity IL-4 [Unconjugated]](https://images.novusbio.com/images/protein/6507-ilcf_recombinant-human-il-4-cho-expressed-protein-cf-bioactivity-272020133214.jpg)
![Bioactivity IFN-gamma [Unconjugated]](https://images.novusbio.com/images2/IFNgamma_285IF_2848.jpg)
![SDS-PAGE IFN-gamma [Unconjugated]](https://images.novusbio.com/images2/IFN-gamma_285-IF_230.jpg)
![SEC-MALS IFN-gamma [Unconjugated]](https://images.novusbio.com/images/285-if_recombinant-human-ifn-gamma-protein-sec-mals-1520239228..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
