Home » Galectin-8 » Galectin-8 Proteins » Galectin-8 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Galectin-8 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Galectin-8 Protein (NBP1-87317PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Galectin-8 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LGALS8.

Source: E. coli

Amino Acid Sequence: PFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSDLQSTQASS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
LGALS8
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87317.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Galectin-8 Recombinant Protein Antigen

  • GAL8
  • Gal-8
  • galectin 8
  • Galectin8
  • Galectin-8
  • galectin-8g
  • lectin, galactoside-binding, soluble, 8
  • LGALS8
  • PCTA1
  • PCTA-1Po66 carbohydrate-binding protein
  • Po66 carbohydrate binding protein
  • Po66-CBP
  • Prostate carcinoma tumor antigen 1

Background

Several proteins have been identified as specific markers of prostate cancer, and they may be useful as diagnostic indicators. PSA, prostate specific antigen, is the classical indicator for transformed prostate tissue; however, in addition to being upregulated in prostate cancer, PSA is also upregulated in non-malignant conditions, such as benign prostatic hyperplasia prostate. Galectin-8, also known as prostate-specific membrane antigen (PCTA-1), is an additional prostate-specific antigen that is overexpressed only in malignant tumors and therefore is a more specific identifier of malignancies. It is a member of the galectin gene family which mediates both cell-cell and cellmatrix interactions in a manner similar to the selectin subgroup of C-type lectins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Galectin-1
Antibody [Unconjugate
AF1152
Intracellular Staining by Flow Cytometry Galectin-1 Antibody [Unconjugated]
Simple Western Galectin-1 Antibody [Unconjugated]
Immunohistochemistry Galectin-1 Antibody [Unconjugated]
(4 Reviews)
(22 Publications)
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Galectin-9
Antibody [Unconjugate
AF2045
Immunocytochemistry Galectin-9 Antibody [Unconjugated]
Western Blot Galectin-9 Antibody [Unconjugated]
Immunohistochemistry Galectin-9 Antibody [Unconjugated]
(1 Review)
(22 Publications)
Species: Hu
Applications: ICC, IHC, WB
Galectin-3
Antibody [Unconjugate
AF1197
Western Blot Galectin-3 Antibody [Unconjugated]
Immunohistochemistry Galectin-3 Antibody [Unconjugated]
Simple Western Galectin-3 Antibody [Unconjugated]
(2 Reviews)
(42 Publications)
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Galectin-4
Antibody [Unconjugate
AF2128
Immunohistochemistry Galectin-4 Antibody [Unconjugated]
(5 Publications)
Species: Mu
Applications: IHC, WB
ERK1 Antibody
(1E5) - BSA Free
NBP2-22203
Flow Cytometry ERK1 Antibody (1E5) - BSA Free
Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free
Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
RPGR Antibody -
Azide and BSA Free
NBP2-93653
Western Blot RPGR Antibody - Azide and BSA Free
Western Blot RPGR Antibody - Azide and BSA Free
Immunohistochemistry-Paraffin RPGR Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
CRX/CORD2 Antibody
(4G11)
H00001406-M02
Western Blot CRX/CORD2 Antibody (4G11)
Immunocytochemistry/ Immunofluorescence CRX/CORD2 Antibody (4G11)
ELISA CRX/CORD2 Antibody (4G11)
(32 Publications)
Species: Bv, Fi, Hu, Mu
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Fibronectin
Antibody - BSA Free
NBP1-91258
Western Blot Fibronectin Antibody - BSA Free
Western Blot Fibronectin Antibody - BSA Free
Western Blot Fibronectin Antibody - BSA Free
(11 Reviews)
(56 Publications)
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
ALCAM/CD166
Antibody [Unconjugate
AF1172
Immunohistochemistry ALCAM/CD166 Antibody [Unconjugated]
Immunocytochemistry ALCAM/CD166 Antibody [Unconjugated]
Western Blot ALCAM/CD166 Antibody [Unconjugated]
(2 Reviews)
(22 Publications)
Species: Ca, Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Kallikrein 3/PSA
[HRP]
DKK300
N/A Kallikrein 3/PSA [HRP]
N/A Kallikrein 3/PSA [HRP]
N/A Kallikrein 3/PSA [HRP]
(17 Publications)
Species: Hu
Applications: ELISA
PYK2/FAK2 [p
Tyr402] Antibody (592 ...
MAB6210
Simple Western PYK2/FAK2 [p Tyr402] Antibody (592918) [Unconjugated]
Western Blot PYK2/FAK2 [p Tyr402] Antibody (592918) [Unconjugated]
(1 Review)
(1 Publication)
Species: Hu
Applications: Simple Western, WB
Galectin-7
Antibody [Unconjugate
AF1339
Western Blot Galectin-7 Antibody [Unconjugated]
Simple Western Galectin-7 Antibody [Unconjugated]
(5 Publications)
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Simple Western, WB
CD4 Antibody - BSA
Free
NBP1-19371
Immunohistochemistry-Frozen CD4 Antibody - BSA Free
Immunohistochemistry-Paraffin CD4 Antibody - BSA Free
Flow Cytometry CD4 Antibody - BSA Free
(9 Reviews)
(50 Publications)
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
PIK3CA Antibody
NBP2-19804
Western Blot PIK3CA Antibody
Immunohistochemistry-Paraffin PIK3CA Antibody
Western Blot PIK3CA Antibody
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
PI 3-Kinase p110
beta/PIK3CB Antibody ...
MAB2686
Western Blot PI 3-Kinase p110 beta/PIK3CB Antibody (269020)
(5 Publications)
Species: Hu
Applications: WB
PI 3-Kinase p110
gamma Antibody
NBP2-15071
Western Blot PI 3-Kinase p110 gamma Antibody
Western Blot PI 3-Kinase p110 gamma Antibody
Immunohistochemistry-Paraffin PI 3-Kinase p110 gamma Antibody
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
PI 3-Kinase p110
delta Antibody (OTI1D ...
NBP2-46404
Immunohistochemistry PI 3-Kinase p110 delta Antibody (OTI1D11)
Immunohistochemistry PI 3-Kinase p110 delta Antibody (OTI1D11)
Immunohistochemistry PI 3-Kinase p110 delta Antibody (OTI1D11)
(1 Review)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
RAR beta/NR1B2
Antibody (336)
NB200-323
Western Blot RAR beta/NR1B2 Antibody (336)
(2 Reviews)
(1 Publication)
Species: Hu, Rt
Applications: WB
Galectin-8
Recombinant Protein A
NBP1-87317PEP
Galectin-8 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for Galectin-8 Protein (NBP1-87317PEP) (0)

There are no publications for Galectin-8 Protein (NBP1-87317PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Galectin-8 Protein (NBP1-87317PEP) (0)

There are no reviews for Galectin-8 Protein (NBP1-87317PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Galectin-8 Protein (NBP1-87317PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Galectin-8 Products

Research Areas for Galectin-8 Protein (NBP1-87317PEP)

Find related products by research area.

Blogs on Galectin-8

There are no specific blogs for Galectin-8, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Western blot shows lysates of LNCaP human prostate cancer cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human Galectin-8 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1305) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for Galectin-8 at approximately 35 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Galectin-8 Antibody [Unconjugated]
AF1305
Western Blot: Fibronectin Antibody - BSA Free [NBP1-91258] - Nicotinamide (NAM) attenuates unilateral urethral obstruction (UUO)-induced renal interstitial fibrosis. C57BL/6 mice were subjected to UUO surgery or sham operation. Different doses of NAM or saline were intraperitoneally injected an hour before the surgery and daily thereafter. Representative images of Western blot of FN (fibronectin), alpha-SMA (alpha-smooth muscle actin) and GAPDH (loading control). Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30993884/) licensed under a CC-BY license.
Fibronectin Antibody - BSA Free
NBP1-91258

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Galectin-8 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol LGALS8