![Immunohistochemistry-Paraffin: FoxJ1/HFH4 Antibody [NBP1-87928] - Staining in human fallopian tube and liver tissues. Corresponding FOXJ1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/FoxJ1-HFH4-Antibody-Immunohistochemistry-Paraffin-NBP1-87928-img0014.jpg "Immunohistochemistry-Paraffin: FoxJ1/HFH4 Antibody [NBP1-87928] - Staining in human fallopian tube and liver tissues. Corresponding FOXJ1 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PREKDEPGKGGFWRIDPQYAERLLSGAFKKRRLPPVHIHPAFARQAAQEPSAVPRAGPLTVNTEAQQLLREFEEATGEAGWGAGEGRLGHKRKQPLPKRVAKVPRPPSTLLPTPEEQGELEPLKG |
| Predicted Species | Mouse (91%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | FOXJ1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Verified Customer |
IHC-Fr | Mouse | 04/18/2019 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for FoxJ1/HFH4 Antibody (NBP1-87928)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | FOXJ1 |
![Immunohistochemistry-Frozen: FoxJ1/HFH4 Antibody [NBP1-87928] - Staining of FoxJ1 in airway epithelium of mouse. Image from verified customer review.](http://images.novusbio.com/fullsize/FoxJ1-HFH4-Antibody-Immunohistochemistry-Frozen-NBP1-87928-img0015.jpg "Immunohistochemistry-Frozen: FoxJ1/HFH4 Antibody [NBP1-87928] - Staining of FoxJ1 in airway epithelium of mouse. Image from verified customer review.")
![Immunohistochemistry-Paraffin: FoxJ1/HFH4 Antibody [NBP1-87928] - Staining of human endometrium shows strong nuclear positivity in a subset of glandular cells.](http://images.novusbio.com/fullsize/FoxJ1-HFH4-Antibody-Immunohistochemistry-Paraffin-NBP1-87928-img0010.jpg "Immunohistochemistry-Paraffin: FoxJ1/HFH4 Antibody [NBP1-87928] - Staining of human endometrium shows strong nuclear positivity in a subset of glandular cells.")
![Immunohistochemistry-Paraffin: FoxJ1/HFH4 Antibody [NBP1-87928] - Staining of human fallopian tube shows strong nuclear positivity in a subset of glandular cells.](http://images.novusbio.com/fullsize/FoxJ1-HFH4-Antibody-Immunohistochemistry-Paraffin-NBP1-87928-img0011.jpg "Immunohistochemistry-Paraffin: FoxJ1/HFH4 Antibody [NBP1-87928] - Staining of human fallopian tube shows strong nuclear positivity in a subset of glandular cells.")
![Immunohistochemistry-Paraffin: FoxJ1/HFH4 Antibody [NBP1-87928] - Staining of human liver shows no positivity as expected.](http://images.novusbio.com/fullsize/FoxJ1-HFH4-Antibody-Immunohistochemistry-Paraffin-NBP1-87928-img0012.jpg "Immunohistochemistry-Paraffin: FoxJ1/HFH4 Antibody [NBP1-87928] - Staining of human liver shows no positivity as expected.")
![Immunohistochemistry-Paraffin: FoxJ1/HFH4 Antibody [NBP1-87928] - Staining of human testis shows moderate nuclear positivity in a subset of cells in seminiferous ducts.](http://images.novusbio.com/fullsize/FoxJ1-HFH4-Antibody-Immunohistochemistry-Paraffin-NBP1-87928-img0013.jpg "Immunohistochemistry-Paraffin: FoxJ1/HFH4 Antibody [NBP1-87928] - Staining of human testis shows moderate nuclear positivity in a subset of cells in seminiferous ducts.")
![Immunohistochemistry Uteroglobin/SCGB1A1 Antibody (394324) [Unconjugated]](https://images.novusbio.com/images2/Uteroglobin_MAB4218_Immunohistochemistry_7019.jpg)
![Immunohistochemistry Uteroglobin/SCGB1A1 Antibody (394324) [Unconjugated]](https://images.novusbio.com/images2/Uteroglobin_MAB4218_Immunohistochemistry_9991.jpg)
![Chromatin Immunoprecipitation (ChIP) HNF-3 beta/FoxA2 Antibody [Unconjugated]](https://images.novusbio.com/images2/HNF-3_beta_AF2400_Chromatin_Immunoprecipitation_11227.jpg)
![Immunocytochemistry HNF-3 beta/FoxA2 Antibody [Unconjugated]](https://images.novusbio.com/images2/HNF-3_beta_AF2400_Immunocytochemistry_6484.jpg)
![Immunohistochemistry HNF-3 beta/FoxA2 Antibody [Unconjugated]](https://images.novusbio.com/images2/HNF3_beta_AF2400_Immunohistochemistry_23167.jpg)
![Western Blot MLX Antibody [Unconjugated]](https://images.novusbio.com/images2/MLX_AF4186_Western_Blot_5416.jpg)
![Immunocytochemistry MLX Antibody [Unconjugated]](https://images.novusbio.com/images2/af4186_human-mlx-affinity-purified-polyclonal-ab-immunocytochemistry-412202015556.jpg)
![Bioactivity Sonic Hedgehog/Shh [Unconjugated]](https://images.novusbio.com/images2/Sonic_Hedgehog_464SH_2840.jpg)
![SDS-PAGE Sonic Hedgehog/Shh [Unconjugated]](https://images.novusbio.com/images2/Sonic_Hedgehog_464-SH_341.jpg)
![SEC-MALS Sonic Hedgehog/Shh [Unconjugated]](https://images.novusbio.com/images/464-sh_recombinant-mouse-sonic-hedgehog-shh-c25ii-n-terminus-sec-mals-642023224324.jpg)
![N/A IL-13 [Biotin]](https://images.novusbio.com/images2/DATA_IL13_DY413_ELISA_2010.jpg)
![Immunohistochemistry PITX2 Antibody [Unconjugated]](https://images.novusbio.com/images2/PITX2_AF7388_Immunohistochemistry_12162.jpg)
![SDS-PAGE BMP-4 [Unconjugated]](https://images.novusbio.com/images2/BMP-4_314-BP_100.jpg)
![Bioactivity BMP-4 [Unconjugated]](https://images.novusbio.com/images2/314-bp_recombinant-human-bmp-4-protein-1882021123744.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
