FGF18 Antibody Summary
Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human FGF18. Peptide sequence: GKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRE The peptide sequence for this immunogen was taken from within the described region. |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
FGF18 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Concentration |
0.5 mg/ml |
Purity |
Affinity purified |
Alternate Names for FGF18 Antibody
Background
FGF18 (fibroblast growth factor 18), belongs to the FGF family which are involved in cell growth, tissue repair, embryonic development and a number of other biological processes. Specifically, FGF18 is crucial for the regulation of cell proliferation, cell differentiation and cell migration. FGF18 is known to have interactions with FGFR2, FGFR1, FGFR3, FGFR4 and FGF1. Disease and disorder research has been conducted in relation to FGF18 and colon cancer, leukemia, melanoma, achondroplasia, cleft lip and carcinoma.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: BA
Species: Hu
Applications: ICC, IHC, WB
Species: Bv, Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Ca, Hu, Mu, Rb, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, Neut, Simple Western, WB
Species: Hu
Applications: ICC
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: BA
Species: Hu
Applications: BA, BA
Species: Hu, Mu
Applications: ICC, IHC, Neut, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
Species: Hu
Applications: BA
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Publications for FGF18 Antibody (NBP2-84022) (0)
There are no publications for FGF18 Antibody (NBP2-84022).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for FGF18 Antibody (NBP2-84022) (0)
There are no reviews for FGF18 Antibody (NBP2-84022).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for FGF18 Antibody (NBP2-84022) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional FGF18 Products
Research Areas for FGF18 Antibody (NBP2-84022)
Find related products by research area.
|
Blogs on FGF18