Home » Fatty Acid Synthase/FASN » Fatty Acid Synthase/FASN Proteins » Fatty Acid Synthase/FASN Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Fatty Acid Synthase/FASN Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Fatty Acid Synthase/FASN Recombinant Protein Antigen (NBP2-49213PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals offers 100% Guarantee

Fatty Acid Synthase/FASN Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Fatty Acid Synthase/FASN.

Source: E. coli

Amino Acid Sequence: MPFRGYAVLGGERGGPEVQQVPAGERPLWFICSGMGTQWRGMGLSLMRLDRFRDSILRSDEAVKPFGLKVSQLLLSTDESTFDDIVHSFVSLTAIQIGLIDLLSCMGLRPDGIVG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
FASN
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49213.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Fatty Acid Synthase/FASN Recombinant Protein Antigen

  • EC 2.3.1
  • EC 2.3.1.85
  • EC 6.3.3.1
  • FASN
  • FASshort chain dehydrogenase/reductase family 27X, member 1
  • Fatty Acid Synthase
  • MGC14367
  • MGC15706
  • OA-519
  • SDR27X1

Background

Fatty Acid Synthase (FAS) is a very large enzymatic system involved in de novo lipogenesis (triglyceride production). Specifically, FAS catalyzes the synthesis of palmitate from acetyl-CoA and malonyl-CoA, in the presence of NADPH, into long-chain saturated fatty acids. It is also one of the accepted markers for insulin resistance and SREBP, LXR activation.

In some cancer cell lines, FAS has been found to be fused with ER-alpha. Therefore, FAS antibodies are useful tools for studies on fatty acid synthesis and research on certian cancers.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

SREBP1 Antibody
(2A4) - BSA Free
NB600-582
Western Blot SREBP1 Antibody (2A4) - BSA Free
Western Blot SREBP1 Antibody (2A4) - BSA Free
Western Blot SREBP1 Antibody (2A4) - BSA Free
(71 Publications)
Species: Ca, Ch, SyHa, Ha, Hu, Pm, Mu, Rt
Applications: IHC-Fr, KO, Simple Western, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(25 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Acetyl-CoA
Carboxylase alpha/ACA ...
MAB6898
Western Blot Acetyl-CoA Carboxylase alpha/ACACA Antibody (738421)
(3 Publications)
Species: Hu, Mu
Applications: WB
Fas Ligand/TNFSF6
[Unconjugated]
126-FL/CF
Fas Ligand/TNFSF6 [Unconjugated]
(20 Publications)
Species: Hu
Applications: BA
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(822 Publications)
Species: Hu
Applications: BA
Lipoprotein
Lipase/LPL Antibody [ ...
AF7197
Immunohistochemistry Lipoprotein Lipase/LPL Antibody [Unconjugated]
Western Blot Lipoprotein Lipase/LPL Antibody [Unconjugated]
Immunocytochemistry Lipoprotein Lipase/LPL Antibody [Unconjugated]
(12 Publications)
Species: Hu, Mu
Applications: ICC, IHC, WB
PPAR gamma/NR1C3
Antibody - BSA Free
NBP2-22106
Western Blot PPAR gamma/NR1C3 Antibody - BSA Free
Immunohistochemistry-Paraffin PPAR gamma/NR1C3 Antibody - BSA Free
Western Blot PPAR gamma/NR1C3 Antibody - BSA Free
(2 Reviews)
(12 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Bcl-2 Antibody
NB100-56098
Western Blot Bcl-2 Antibody
Western Blot Bcl-2 Antibody
Western Blot Bcl-2 Antibody
(2 Reviews)
(28 Publications)
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(43 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Leptin/OB [HRP]
DLP00
N/A Leptin/OB [HRP]
N/A Leptin/OB [HRP]
(157 Publications)
Species: Hu
Applications: ELISA
Caspase-3 Antibody
[Unconjugated] - Acti ...
AF835
Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active
Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active
Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active
(7 Reviews)
(389 Publications)
Species: Hu, Mu
Applications: ICC, IHC
AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(50 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
SCD-1 Antibody
[Unconjugated]
AF7550
Western Blot SCD-1 Antibody [Unconjugated]
Knockout Validated SCD-1 Antibody [Unconjugated]
Knockout Validated SCD-1 Antibody [Unconjugated]
(1 Review)
(1 Publication)
Species: Hu
Applications: IP, KO, WB
ErbB2/Her2
[Unconjugated]
1129-ER
SDS-PAGE ErbB2/Her2 [Unconjugated]
Bioactivity ErbB2/Her2 [Unconjugated]
(58 Publications)
Species: Hu
Applications: BA
Caspase-8 Antibody
NB100-56116
Western Blot Caspase-8 Antibody
Immunohistochemistry-Paraffin Caspase-8 Antibody
Immunohistochemistry-Paraffin Caspase-8 Antibody
(2 Reviews)
(82 Publications)
Species: Ma, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
PPAR alpha/NR1C1
Antibody (3B6/PPAR) - ...
NB300-537
Flow Cytometry PPAR alpha/NR1C1 Antibody (3B6/PPAR) - BSA Free
Western Blot PPAR alpha/NR1C1 Antibody (3B6/PPAR) - BSA Free
Flow Cytometry PPAR alpha/NR1C1 Antibody (3B6/PPAR) - BSA Free
(1 Review)
(16 Publications)
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin p21/CIP1/CDKN1A Antibody (WA-1)
(24 Publications)
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Bax Antibody (6A7)
NBP1-28566
Western Blot Bax Antibody (6A7)
Western Blot Bax Antibody (6A7)
Immunohistochemistry-Frozen Bax Antibody (6A7)
(3 Reviews)
(21 Publications)
Species: Bv, Hu, Pm, Mu, Po, Rt
Applications: Func, IHC, IHC-Fr, IHC-P, WB
Thyroglobulin
Antibody (2H11 + 6E1)
NBP2-34294
Immunohistochemistry-Paraffin Thyroglobulin Antibody (2H11 + 6E1)
Immunohistochemistry Thyroglobulin Antibody (2H11 + 6E1)
Immunohistochemistry-Paraffin Thyroglobulin Antibody (2H11 + 6E1)
(3 Reviews)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
Fatty Acid
Synthase/FASN Recombi ...
NBP2-49213PEP
Fatty Acid Synthase/FASN Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for Fatty Acid Synthase/FASN Recombinant Protein Antigen (NBP2-49213PEP) (0)

There are no publications for Fatty Acid Synthase/FASN Recombinant Protein Antigen (NBP2-49213PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Fatty Acid Synthase/FASN Recombinant Protein Antigen (NBP2-49213PEP) (0)

There are no reviews for Fatty Acid Synthase/FASN Recombinant Protein Antigen (NBP2-49213PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Fatty Acid Synthase/FASN Recombinant Protein Antigen (NBP2-49213PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Fatty Acid Synthase/FASN Products

Research Areas for Fatty Acid Synthase/FASN Recombinant Protein Antigen (NBP2-49213PEP)

Find related products by research area.

Blogs on Fatty Acid Synthase/FASN

There are no specific blogs for Fatty Acid Synthase/FASN, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Immunocytochemistry/Immunofluorescence: Fatty Acid Synthase/FASN Antibody [NB400-114] - Fatty acid synthesis requirement for CHIKV life cycle. Confocal section of CHIKV replicon-infected HeLa cells labelled for FASN, dsRNA and 4,6-diamidino-2-phenylindole (DAPI; blue). Scale bar, 10 um. Image collected and cropped by CiteAb from the following publication (https://www.nature.com/doifinder/10.1038/ncomms11320), licensed under a CC-BY license.
Fatty Acid Synthase/FASN Antibody
NB400-114
Caspase‑3 was detected in immersion fixed anti-FAS treated Jurkat human acute T cell leukemia cell line using 0.3 µg/mL Human/Mouse Active Caspase‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF835) for 3 hours at room temperature. Cells were stained (red) and counterstained (green). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Caspase-3 Antibody [Unconjugated] - Active
AF835

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Fatty Acid Synthase/FASN Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol FASN