Fast skeletal myosin light chain 1 Antibody Summary
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human Fast skeletal myosin light chain 1 (NP_524146.1).
Sequence: MSFSADQIAEFKEAFLLFDRTGDSKITLSQVGDVLRALGTNPTNAEVRKVLGNPSNEELNAKKIEFEQFLPMMQAISNNKDQATYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALMAGQEDSNGCINYEAFVKHIMSI |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
MYL1 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Western Blot 1:500 - 1:2000
|
Theoretical MW |
21 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.3), 50% glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for Fast skeletal myosin light chain 1 Antibody
Background
Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain expressed in fast skeletal muscle. Two transcript variants have been identified for this gene. (provided by RefSeq)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: All-Multi
Applications: ICC, IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, WB
Species: Hu
Applications: IP, WB
Species: Hu
Applications: ICC, WB
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: IHC, Simple Western, WB
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: BA
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Publications for Fast skeletal myosin light chain 1 Antibody (NBP3-38544) (0)
There are no publications for Fast skeletal myosin light chain 1 Antibody (NBP3-38544).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Fast skeletal myosin light chain 1 Antibody (NBP3-38544) (0)
There are no reviews for Fast skeletal myosin light chain 1 Antibody (NBP3-38544).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Fast skeletal myosin light chain 1 Antibody (NBP3-38544) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Fast skeletal myosin light chain 1 Products
Research Areas for Fast skeletal myosin light chain 1 Antibody (NBP3-38544)
Find related products by research area.
|
Blogs on Fast skeletal myosin light chain 1