![Western Blot: Eukaryotic translation initiation factor 1 Antibody [NBP3-03239] - Analysis of extracts of various cell lines, using Eukaryotic translation initiation factor 1 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: Blocking buffer: 3% nonfat dry milk in TBST.](http://images.novusbio.com/fullsize/Eukaryotic-translation-initiation-factor-1-Antibody-Western-Blot-NBP3-03239-img0001.jpg "Western Blot: Eukaryotic translation initiation factor 1 Antibody [NBP3-03239] - Analysis of extracts of various cell lines, using Eukaryotic translation initiation factor 1 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: Blocking buffer: 3% nonfat dry milk in TBST.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-113 of human Eukaryotic translation initiation factor 1 (NP_005792.1). MSAIQNLHSFDPFADASKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAKDDQLKVHGF |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | EIF1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 12 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS with 50% glycerol, pH7.3. |
| Preservative | 0.01% Thimerosal |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Eukaryotic translation initiation factor 1 Antibody (NBP3-03239)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | EIF1 |
![Western Blot eIF4E [p Ser209] Antibody](https://images.novusbio.com/images/eIF4E-[p-Ser209]-Antibody-Western-Blot-NB100-81898-img0009.jpg)
![Immunocytochemistry/ Immunofluorescence eIF4E [p Ser209] Antibody](https://images.novusbio.com/images/eIF4E-[p-Ser209]-Antibody-Immunocytochemistry-Immunofluorescence-NB100-81898-img0005.jpg)
![Immunohistochemistry-Paraffin eIF4E [p Ser209] Antibody](https://images.novusbio.com/images/eIF4E-[p-Ser209]-Antibody-Immunohistochemistry-NB100-81898-img0006.jpg)
![Immunohistochemistry CD55/DAF Antibody [Unconjugated]](https://images.novusbio.com/images2/CD55_AF2009_Immunohistochemistry_6728.jpg)
![Immunocytochemistry CD55/DAF Antibody [Unconjugated]](https://images.novusbio.com/images2/CD55_AF2009_Immunocytochemistry__Immunofluorescence_23052.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")