![Immunohistochemistry-Paraffin: EPLIN Antibody [NBP1-87947] -Analysis in human rectum and liver tissues using NBP1-87947 antibody. Corresponding LIMA1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/antibody/nbp1-87947_rabbit-polyclonal-eplin-antibody-immunohistochemistry-paraffin-35202475440..jpg "Immunohistochemistry-Paraffin: EPLIN Antibody [NBP1-87947] -Analysis in human rectum and liver tissues using NBP1-87947 antibody. Corresponding LIMA1 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ISENSYSLDDLEIGPGQLSSSTFDSEKNESRRNLELPRLSETSIKDRMAKYQAAVSKQSSSTNYTNELKASGGEIKIHKMEQKENVPPGPEVCITHQEGEKISANENSLAVRSTPAEDDSRDS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | LIMA1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval method is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Theoretical MW | 85 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Simple_Western_21454.jpg)
![Western Blot EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Western_Blot_21511.jpg)
![Immunocytochemistry EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Immunocytochemistry__Immunofluorescence_17288.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: EPLIN Antibody [NBP1-87947] - Staining of human liver, pancreas, rectum and testis using Anti-LIMA1 antibody NBP1-87947 (A) shows similar protein distribution across tissues to independent antibody NBP2-38673 (B).](http://images.novusbio.com/fullsize/EPLIN-Antibody-Immunohistochemistry-Paraffin-NBP1-87947-img0017.jpg "Immunohistochemistry-Paraffin: EPLIN Antibody [NBP1-87947] - Staining of human liver, pancreas, rectum and testis using Anti-LIMA1 antibody NBP1-87947 (A) shows similar protein distribution across tissues to independent antibody NBP2-38673 (B).")
![Western Blot: EPLIN Antibody [NBP1-87947] - Analysis in human cell lines A-431 and A-549. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.](http://images.novusbio.com/fullsize/EPLIN-Antibody-Western-Blot-NBP1-87947-img0011.jpg "Western Blot: EPLIN Antibody [NBP1-87947] - Analysis in human cell lines A-431 and A-549. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.")
![Western Blot: EPLIN Antibody [NBP1-87947] - Analysis using Anti-LIMA1 antibody NBP1-87947 (A) shows similar pattern to independent antibody NBP2-38673 (B).](http://images.novusbio.com/fullsize/EPLIN-Antibody-Western-Blot-NBP1-87947-img0018.jpg "Western Blot: EPLIN Antibody [NBP1-87947] - Analysis using Anti-LIMA1 antibody NBP1-87947 (A) shows similar pattern to independent antibody NBP2-38673 (B).")
![Immunocytochemistry/Immunofluorescence: EPLIN Antibody [NBP1-87947] - Staining of human cell line U-2 OS shows localization to plasma membrane, cytosol and actin filaments. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/EPLIN-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87947-img0016.jpg "Immunocytochemistry/Immunofluorescence: EPLIN Antibody [NBP1-87947] - Staining of human cell line U-2 OS shows localization to plasma membrane, cytosol and actin filaments. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: EPLIN Antibody [NBP1-87947] - Staining of human rectum shows high expression.](http://images.novusbio.com/fullsize/EPLIN-Antibody-Immunohistochemistry-Paraffin-NBP1-87947-img0013.jpg "Immunohistochemistry-Paraffin: EPLIN Antibody [NBP1-87947] - Staining of human rectum shows high expression.")
![Immunohistochemistry-Paraffin: EPLIN Antibody [NBP1-87947] - Staining of human liver.](http://images.novusbio.com/fullsize/EPLIN-Antibody-Immunohistochemistry-Paraffin-NBP1-87947-img0020.jpg "Immunohistochemistry-Paraffin: EPLIN Antibody [NBP1-87947] - Staining of human liver.")
![Immunohistochemistry-Paraffin: EPLIN Antibody [NBP1-87947] - Staining of human skin shows moderate membranous and cytoplasmic positivity in squamous epithelial cells.](http://images.novusbio.com/fullsize/antibody/nbp1-87947_rabbit-polyclonal-eplin-antibody-immunohistochemistry-paraffin-35202475610..jpg "Immunohistochemistry-Paraffin: EPLIN Antibody [NBP1-87947] - Staining of human skin shows moderate membranous and cytoplasmic positivity in squamous epithelial cells.")
![Immunohistochemistry-Paraffin: EPLIN Antibody [NBP1-87947] - Staining of human prostate shows strong membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/antibody/nbp1-87947_rabbit-polyclonal-eplin-antibody-immunohistochemistry-paraffin-35202475728..jpg "Immunohistochemistry-Paraffin: EPLIN Antibody [NBP1-87947] - Staining of human prostate shows strong membranous positivity in glandular cells.")
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Simple Western Vinculin Antibody (728526) [Unconjugated]](https://images.novusbio.com/images2/Vinculin_MAB6896_Simple_Western_16408.jpg)
![Western Blot Vinculin Antibody (728526) [Unconjugated]](https://images.novusbio.com/images2/Vinculin_MAB6896_Western_Blot_11566.jpg)
![Immunohistochemistry Vinculin Antibody (728526) [Unconjugated]](https://images.novusbio.com/images2/Vinculin_MAB6896_Immunohistochemistry_11621.jpg)
![Western Blot HAX-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/HAX-1_AF5458_Western_Blot_5727.jpg)
![Immunocytochemistry HAX-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/HAX1_AF5458_Immunocytochemistry__Immunofluorescence_18999.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")