![Western Blot: CKS2 Antibody (2H5-2C4) [H00001164-M01] - Analysis of CKS2 expression in transfected 293T cell line by CKS2 monoclonal antibody (M01), clone 2H5-2C4.Lane 1: CKS2 transfected lysate(9.9 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/CKS2-Antibody-2H5-2C4-Western-Blot-H00001164-M01-img0006.jpg "Western Blot: CKS2 Antibody (2H5-2C4) [H00001164-M01] - Analysis of CKS2 expression in transfected 293T cell line by CKS2 monoclonal antibody (M01), clone 2H5-2C4.Lane 1: CKS2 transfected lysate(9.9 KDa).Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, ICC/IF |
| Clone | 2H5-2C4 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | CKS2 (AAH06458, 1 a.a. ~ 79 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQK |
| Specificity | CKS2 - CDC28 protein kinase regulatory subunit 2 |
| Isotype | IgG2b Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | CKS2 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactivity against recombinant protein for WB. It has been used for IF and ELISA. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for CKS2 Antibody (H00001164-M01)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: CKS2 Antibody (2H5-2C4) [H00001164-M01] - Analysis of monoclonal antibody to CKS2 on HeLa cell. Antibody concentration 10 ug/ml.](http://images.novusbio.com/fullsize/CKS2-Antibody-2H5-2C4-Immunocytochemistry-Immunofluorescence-H00001164-M01-img0004.jpg "Immunocytochemistry/Immunofluorescence: CKS2 Antibody (2H5-2C4) [H00001164-M01] - Analysis of monoclonal antibody to CKS2 on HeLa cell. Antibody concentration 10 ug/ml.")
![ELISA: CKS2 Antibody (2H5-2C4) [H00001164-M01] - Detection limit for recombinant GST tagged CKS2 is approximately 3ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/CKS2-Antibody-2H5-2C4-ELISA-H00001164-M01-img0002.jpg "ELISA: CKS2 Antibody (2H5-2C4) [H00001164-M01] - Detection limit for recombinant GST tagged CKS2 is approximately 3ng/ml as a capture antibody.")
![Sandwich ELISA: CKS2 Antibody (2H5-2C4) [H00001164-M01] - Detection limit for recombinant GST tagged CKS2 is approximately 3ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/CKS2-Antibody-2H5-2C4-Sandwich-ELISA-H00001164-M01-img0005.jpg "Sandwich ELISA: CKS2 Antibody (2H5-2C4) [H00001164-M01] - Detection limit for recombinant GST tagged CKS2 is approximately 3ng/ml as a capture antibody.")
![Immunohistochemistry Cyclin B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cyclin_B1_AF6000_Immunohistochemistry_11792.jpg)
![Western Blot Cyclin B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cyclin_B1_AF6000_Western_Blot_9526.jpg)
![Simple Western Cyclin B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cyclin_B1_AF6000_Simple_Western_20094.jpg)
![TIMP-3 [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "TIMP-3 [Unconjugated]")
