![Western Blot: BCL7B Antibody (6D2) [H00009275-M01] - BCL7B monoclonal antibody (M01), clone 6D2. Analysis of BCL7B expression in MCF-7.](http://images.novusbio.com/fullsize/BCL7B-Antibody-6D2-Western-Blot-H00009275-M01-img0006.jpg "Western Blot: BCL7B Antibody (6D2) [H00009275-M01] - BCL7B monoclonal antibody (M01), clone 6D2. Analysis of BCL7B expression in MCF-7.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IHC |
| Clone | 6D2 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | BCL7B (NP_001698, 124 a.a. ~ 202 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AHTSDFRTDDSQPPTLGQEILEEPSLPSSEVADEPPTLTKEEPVPLETQVVEEEEDSGAPPLKRFCVDQPTVPQTASES |
| Specificity | BCL7B - B-cell CLL/lymphoma 7B |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | BCL7B |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
| Publication using H00009275-M01 | Applications | Species |
|---|---|---|
| Taniuchi K, Furihata M, Naganuma S et al. BCL7B, a predictor of poor prognosis of pancreatic cancers, promotes cell motility and invasion by influencing CREB signaling. Am J Cancer Res 2018-03-01 [PMID: 29636996] |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: BCL7B Antibody (6D2) [H00009275-M01] - Analysis of monoclonal antibody to BCL7B on HeLa cell . Antibody concentration 10 ug/ml.](http://images.novusbio.com/fullsize/BCL7B-Antibody-6D2-Immunocytochemistry-Immunofluorescence-H00009275-M01-img0004.jpg "Immunocytochemistry/Immunofluorescence: BCL7B Antibody (6D2) [H00009275-M01] - Analysis of monoclonal antibody to BCL7B on HeLa cell . Antibody concentration 10 ug/ml.")
![Western Blot: BCL7B Antibody (6D2) [H00009275-M01] - Analysis of BCL7B expression in transfected 293T cell line by BCL7B monoclonal antibody (M01), clone 6D2.Lane 1: BCL7B transfected lysate(22 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/BCL7B-Antibody-6D2-Western-Blot-H00009275-M01-img0007.jpg "Western Blot: BCL7B Antibody (6D2) [H00009275-M01] - Analysis of BCL7B expression in transfected 293T cell line by BCL7B monoclonal antibody (M01), clone 6D2.Lane 1: BCL7B transfected lysate(22 KDa).Lane 2: Non-transfected lysate.")
![ELISA: BCL7B Antibody (6D2) [H00009275-M01] - Detection limit for recombinant GST tagged BCL7B is approximately 0.1ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/BCL7B-Antibody-6D2-ELISA-H00009275-M01-img0008.jpg "ELISA: BCL7B Antibody (6D2) [H00009275-M01] - Detection limit for recombinant GST tagged BCL7B is approximately 0.1ng/ml as a capture antibody.")
![N/A C-Reactive Protein/CRP [Biotin]](https://images.novusbio.com/images2/DATA_CReactive_Protein_DY1707_ELISA_1701.jpg)
![Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.](https://images.novusbio.com/images/Mouse-IgG1-Kappa-Light-Chain-Isotype-Control-P3-6-2-8-1-Flow-Cytometry-NBP1-43319-img0002.jpg "Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.")