![Western Blot: Endophilin B1/Bif-1 Antibody [NBP1-89973] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://images.novusbio.com/fullsize/Endophilin-B1-Bif-1-Antibody-Western-Blot-NBP1-89973-img0005.jpg "Western Blot: Endophilin B1/Bif-1 Antibody [NBP1-89973] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).")
| Reactivity | Hu, Rt, MuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: THAHHLRCLNDFVEAQMTYYAQCYQYMLDLQKQLGSFPSNYLSNNNQTSVTPVPSVLPNAIGSSAMASTSGLVITSPSNLSDLKECSGSRKARVLYDYDAANSTELSLLADEVITVFSVVGMDSD |
| Predicted Species | Mouse (90%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SH3GLB1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunohistochemistry_20892.jpg)
![Immunocytochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunocytochemistry__Immunofluorescence_21143.jpg)
![Western Blot EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Western_Blot_19925.jpg)
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Bif-1/Endophilin-B1 Antibody (NBP1-89973)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SH3GLB1 |
![Immunohistochemistry-Paraffin: Endophilin B1/Bif-1 Antibody [NBP1-89973] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/fullsize/Endophilin-B1-Bif-1-Antibody-Immunohistochemistry-Paraffin-NBP1-89973-img0006.jpg "Immunohistochemistry-Paraffin: Endophilin B1/Bif-1 Antibody [NBP1-89973] - Staining of human pancreas shows low expression as expected.")
![Western Blot: Endophilin B1/Bif-1 Antibody [NBP1-89973] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-62](http://images.novusbio.com/fullsize/Endophilin-B1-Bif-1-Antibody-Western-Blot-NBP1-89973-img0004.jpg "Western Blot: Endophilin B1/Bif-1 Antibody [NBP1-89973] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-62")
![Immunohistochemistry-Paraffin: Endophilin B1/Bif-1 Antibody [NBP1-89973] - Staining of human testis shows distinct cytoplasmic positivity in cells in seminiferus ducts.](http://images.novusbio.com/fullsize/Endophilin-B1-Bif-1-Antibody-Immunohistochemistry-Paraffin-NBP1-89973-img0002.jpg "Immunohistochemistry-Paraffin: Endophilin B1/Bif-1 Antibody [NBP1-89973] - Staining of human testis shows distinct cytoplasmic positivity in cells in seminiferus ducts.")
![Immunohistochemistry-Paraffin: Endophilin B1/Bif-1 Antibody [NBP1-89973] - Staining in human testis and pancreas tissues using anti-SH3GLB1 antibody. Corresponding SH3GLB1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Endophilin-B1-Bif-1-Antibody-Immunohistochemistry-Paraffin-NBP1-89973-img0007.jpg "Immunohistochemistry-Paraffin: Endophilin B1/Bif-1 Antibody [NBP1-89973] - Staining in human testis and pancreas tissues using anti-SH3GLB1 antibody. Corresponding SH3GLB1 RNA-seq data are presented for the same tissues.")
![Western Blot BAK Antibody [Unconjugated]](https://images.novusbio.com/images2/BAK_AF816_Western_Blot_5904.jpg)
![Immunocytochemistry BAK Antibody [Unconjugated]](https://images.novusbio.com/images2/BAK_AF816_Immunocytochemistry__Immunofluorescence_22091.jpg)
![Immunohistochemistry BAK Antibody [Unconjugated]](https://images.novusbio.com/images/af816_human-bak-affinity-purified-polyclonal-ab-immunohistochemistry-26420239384.jpg)
![SDS-PAGE IL-3 [Unconjugated]](https://images.novusbio.com/images2/IL-3_203-IL_345.jpg)
![Bioactivity IL-3 [Unconjugated]](https://images.novusbio.com/images2/IL-3_203-IL_347.jpg)
![SEC-MALS IL-3 [Unconjugated]](https://images.novusbio.com/images/203-il_recombinant-human-il-3-protein-sec-mals-133202482656..jpg)
![SDS-PAGE EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236-EG_234.jpg)
![Bioactivity EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236EG_1570.jpg)
![Cell Culture EGF [Unconjugated]](https://images.novusbio.com/images/236-eg_recombinant-human-egf-protein-cf-bioactivity-25202394053.jpg)
![Western Blot Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/Src_AF2685_Western_Blot_5209.jpg)
![Simple Western Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/16327.jpg)
![Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/Src_AF2685_Immunohistochemistry_7158.jpg)
![N/A Trappin-2/Elafin/Skalp [Biotin]](https://images.novusbio.com/images2/DATA_Trappin2_DY1747_ELISA_1708.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")