![Immunohistochemistry-Paraffin: Eg5 Antibody [NBP1-84887] - Analysis in human tonsil and pancreas tissues. Corresponding KIF11 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Eg5-Antibody-Immunohistochemistry-Paraffin-NBP1-84887-img0012.jpg "Immunohistochemistry-Paraffin: Eg5 Antibody [NBP1-84887] - Analysis in human tonsil and pancreas tissues. Corresponding KIF11 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ALIKEYTEEIERLKRDLAAAREKNGVYISEENFRVMSGKLTVQEEQIVELIEKIGAVEEELNRVTELFMDNKNELDQCKSDLQNKTQELETTQKHLQETKLQLVK |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | KIF11 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-84887 | Applications | Species |
|---|---|---|
| Kuga T, Nie H, Kazami T et al. Lamin B2 prevents chromosome instability by ensuring proper mitotic chromosome segregation. Oncogenesis 2014-03-17 [PMID: 24637494] |
Secondary Antibodies |
Isotype Controls |
Research Areas for Eg5 Antibody (NBP1-84887)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | KIF11 |
![Western Blot: Eg5 Antibody [NBP1-84887] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/Eg5-Antibody-Western-Blot-NBP1-84887-img0008.jpg "Western Blot: Eg5 Antibody [NBP1-84887] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Immunohistochemistry-Paraffin: Eg5 Antibody [NBP1-84887] - Staining of human tonsil shows moderate to strong cytoplasmic positivity, mainly in germinal center cells.](http://images.novusbio.com/fullsize/Eg5-Antibody-Immunohistochemistry-Paraffin-NBP1-84887-img0015.jpg "Immunohistochemistry-Paraffin: Eg5 Antibody [NBP1-84887] - Staining of human tonsil shows moderate to strong cytoplasmic positivity, mainly in germinal center cells.")
![Western Blot: Eg5 Antibody [NBP1-84887] - Analysis in human cell line A-431.](http://images.novusbio.com/fullsize/Eg5-Antibody-Western-Blot-NBP1-84887-img0007.jpg "Western Blot: Eg5 Antibody [NBP1-84887] - Analysis in human cell line A-431.")
![Immunohistochemistry-Paraffin: Eg5 Antibody [NBP1-84887] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/Eg5-Antibody-Immunohistochemistry-Paraffin-NBP1-84887-img0013.jpg "Immunohistochemistry-Paraffin: Eg5 Antibody [NBP1-84887] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: Eg5 Antibody [NBP1-84887] - Staining of human duodenum shows moderate to strong cytoplasmic positivity in a subset of glandular cells.](http://images.novusbio.com/fullsize/Eg5-Antibody-Immunohistochemistry-Paraffin-NBP1-84887-img0014.jpg "Immunohistochemistry-Paraffin: Eg5 Antibody [NBP1-84887] - Staining of human duodenum shows moderate to strong cytoplasmic positivity in a subset of glandular cells.")
![Immunohistochemistry-Paraffin: Eg5 Antibody [NBP1-84887] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.](http://images.novusbio.com/fullsize/Eg5-Antibody-Immunohistochemistry-Paraffin-NBP1-84887-img0016.jpg "Immunohistochemistry-Paraffin: Eg5 Antibody [NBP1-84887] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.")
![Insulysin/IDE [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Insulysin/IDE [Unconjugated]")
![Immunocytochemistry Mxi1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Mxi1_AF4185_Immunocytochemistry__Immunofluorescence_20286.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")