![Western Blot: KIF15 Antibody [NBP3-17874] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10; Lane 2: RT4; Lane 3: U-251 MG; Lane 4: Human Plasma; Lane 5: Liver; Lane 6: Tonsil](http://images.novusbio.com/fullsize/KIF15-Antibody-Western-Blot-NBP3-17874-img0002.jpg "Western Blot: KIF15 Antibody [NBP3-17874] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10; Lane 2: RT4; Lane 3: U-251 MG; Lane 4: Human Plasma; Lane 5: Liver; Lane 6: Tonsil")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RPVPKLSPEMGSFGSLYTQNSSILDNDILNEPVPPEMNEQAFEAISEELRTVQEQMSALQAKLDEEEHKNLKLQQHVD |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | KIF15 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, pH 7.2, 40% glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
|
Ki67 - an established marker for labelling proliferating cells Ki-67/MKI67 is an antigen which is expressed during G1, S, G2, and M phases of the cell cycle (mitotically active cells), but not during G0 phase (resting cells). It is a large protein with expected molecular weight of about 395 kDa, and it has a v... Read full blog post. |
|
Ki67 - A Crucial Cellular Proliferation Marker The Ki67 antigen is a prototypic cell cycle-related protein expressed by proliferating cells in all phases of the active cell cycle (G1, S, G2 and M). It is a non-histone nuclear protein originally identified in a Hodgkin's lymphoma-derived cell line.... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | KIF15 |
![Immunohistochemistry-Paraffin: KIF15 Antibody [NBP3-17874] - Staining of human thymus shows nuclear membraneous positivity in medullary and cortical cells.](http://images.novusbio.com/fullsize/KIF15-Antibody-Immunohistochemistry-Paraffin-NBP3-17874-img0001.jpg "Immunohistochemistry-Paraffin: KIF15 Antibody [NBP3-17874] - Staining of human thymus shows nuclear membraneous positivity in medullary and cortical cells.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")