![Western Blot: ECHS1 Antibody [NBP1-87078] - Analysis using Anti-ECHS1 antibody NBP1-87078 (A) shows similar pattern to independent antibody NBP1-87079 (B).](http://images.novusbio.com/fullsize/ECHS1-Antibody-Western-Blot-NBP1-87078-img0012.jpg "Western Blot: ECHS1 Antibody [NBP1-87078] - Analysis using Anti-ECHS1 antibody NBP1-87078 (A) shows similar pattern to independent antibody NBP1-87079 (B).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: CDIIYAGEKAQFAQPEILIGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKICPVETLVEEAIQCAEKIASNSKIVVAMAKESVNAAFEMTLTEGSKLEKKLFYSTFATDDRKEGMTAFVEKRKANFKDQ |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ECHS1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for ECHS1 Antibody (NBP1-87078)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ECHS1 |
![Immunocytochemistry/Immunofluorescence: ECHS1 Antibody [NBP1-87078] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.](http://images.novusbio.com/fullsize/ECHS1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87078-img0008.jpg "Immunocytochemistry/Immunofluorescence: ECHS1 Antibody [NBP1-87078] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.")
![Immunohistochemistry-Paraffin: ECHS1 Antibody [NBP1-87078] - Staining of human kidney.](http://images.novusbio.com/fullsize/ECHS1-Antibody-Immunohistochemistry-Paraffin-NBP1-87078-img0015.jpg "Immunohistochemistry-Paraffin: ECHS1 Antibody [NBP1-87078] - Staining of human kidney.")
![Western Blot: ECHS1 Antibody [NBP1-87078] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://images.novusbio.com/fullsize/ECHS1-Antibody-Western-Blot-NBP1-87078-img0006.jpg "Western Blot: ECHS1 Antibody [NBP1-87078] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).")
![Immunohistochemistry-Paraffin: ECHS1 Antibody [NBP1-87078] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/ECHS1-Antibody-Immunohistochemistry-Paraffin-NBP1-87078-img0007.jpg "Immunohistochemistry-Paraffin: ECHS1 Antibody [NBP1-87078] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: ECHS1 Antibody [NBP1-87078] - Staining of human skeletal muscle shows low expression as expected.](http://images.novusbio.com/fullsize/ECHS1-Antibody-Immunohistochemistry-Paraffin-NBP1-87078-img0009.jpg "Immunohistochemistry-Paraffin: ECHS1 Antibody [NBP1-87078] - Staining of human skeletal muscle shows low expression as expected.")
![Immunohistochemistry-Paraffin: ECHS1 Antibody [NBP1-87078] - Staining in human liver and skeletal muscle tissues using anti-ECHS1 antibody. Corresponding ECHS1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/ECHS1-Antibody-Immunohistochemistry-Paraffin-NBP1-87078-img0010.jpg "Immunohistochemistry-Paraffin: ECHS1 Antibody [NBP1-87078] - Staining in human liver and skeletal muscle tissues using anti-ECHS1 antibody. Corresponding ECHS1 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: ECHS1 Antibody [NBP1-87078] - Staining of human cerebral cortex, kidney, liver and testis using Anti-ECHS1 antibody NBP1-87078 (A) shows similar protein distribution across tissues to independent antibody NBP1-87079 (B).](http://images.novusbio.com/fullsize/ECHS1-Antibody-Immunohistochemistry-Paraffin-NBP1-87078-img0011.jpg "Immunohistochemistry-Paraffin: ECHS1 Antibody [NBP1-87078] - Staining of human cerebral cortex, kidney, liver and testis using Anti-ECHS1 antibody NBP1-87078 (A) shows similar protein distribution across tissues to independent antibody NBP1-87079 (B).")
![Immunohistochemistry-Paraffin: ECHS1 Antibody [NBP1-87078] - Staining of human testis.](http://images.novusbio.com/fullsize/ECHS1-Antibody-Immunohistochemistry-Paraffin-NBP1-87078-img0013.jpg "Immunohistochemistry-Paraffin: ECHS1 Antibody [NBP1-87078] - Staining of human testis.")
![Immunohistochemistry-Paraffin: ECHS1 Antibody [NBP1-87078] - Staining of human cerebral cortex.](http://images.novusbio.com/fullsize/ECHS1-Antibody-Immunohistochemistry-Paraffin-NBP1-87078-img0014.jpg "Immunohistochemistry-Paraffin: ECHS1 Antibody [NBP1-87078] - Staining of human cerebral cortex.")
![Western Blot Annexin A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Annexin_A1_AF3770_Western_Blot_5334.jpg)
![Immunohistochemistry Annexin A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Annexin_A1_AF3770_Immunohistochemistry_10404.jpg)
![Simple Western Annexin A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Annexin_A1_AF3770_Simple_Western_16649.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")