![Western Blot: ACSL5 Antibody (5H8) [H00051703-M01] - ACSL5 monoclonal antibody (M01), clone 5H8 Analysis of ACSL5 expression in HepG2.](http://images.novusbio.com/fullsize/ACSL5-Antibody-5H8-Western-Blot-H00051703-M01-img0012.jpg "Western Blot: ACSL5 Antibody (5H8) [H00051703-M01] - ACSL5 monoclonal antibody (M01), clone 5H8 Analysis of ACSL5 expression in HepG2.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, IHC, IP |
| Clone | 5H8 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | ACSL5 (NP_057318, 91 a.a. ~ 186 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PQPVLPLLDLNNQSVGIEGGARKGVSQKNNDLTSCCFSDAKTMYEVFQRGLAVSDNGPCLGYRKPNQPYRWLSYKQVSDRAEYLGSCLLHKGYKSS |
| Specificity | ACSL5 - acyl-CoA synthetase long-chain family member 5 |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | ACSL5 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for ACSL5 Antibody (H00051703-M01)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: ACSL5 Antibody (5H8) [H00051703-M01] - Analysis of monoclonal antibody to ACSL5 on formalin-fixed paraffin-embedded human colon. Antibody concentration 3 ug/ml.](http://images.novusbio.com/fullsize/ACSL5-Antibody-5H8-Immunohistochemistry-Paraffin-H00051703-M01-img0009.jpg "Immunohistochemistry-Paraffin: ACSL5 Antibody (5H8) [H00051703-M01] - Analysis of monoclonal antibody to ACSL5 on formalin-fixed paraffin-embedded human colon. Antibody concentration 3 ug/ml.")
![Western Blot: ACSL5 Antibody (5H8) [H00051703-M01] - Analysis of ACSL5 expression in transfected 293T cell line by ACSL5 monoclonal antibody (M01), clone 5H8.Lane 1: ACSL5 transfected lysate(82.3 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/ACSL5-Antibody-5H8-Western-Blot-H00051703-M01-img0013.jpg "Western Blot: ACSL5 Antibody (5H8) [H00051703-M01] - Analysis of ACSL5 expression in transfected 293T cell line by ACSL5 monoclonal antibody (M01), clone 5H8.Lane 1: ACSL5 transfected lysate(82.3 KDa).Lane 2: Non-transfected lysate.")
![Immunoprecipitation: ACSL5 Antibody (5H8) [H00051703-M01] - Analysis of ACSL5 transfected lysate using anti-ACSL5 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with ACSL5 MaxPab rabbit polyclonal antibody.](http://images.novusbio.com/fullsize/ACSL5-Antibody-5H8-Immunoprecipitation-H00051703-M01-img0010.jpg "Immunoprecipitation: ACSL5 Antibody (5H8) [H00051703-M01] - Analysis of ACSL5 transfected lysate using anti-ACSL5 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with ACSL5 MaxPab rabbit polyclonal antibody.")
![Sandwich ELISA: ACSL5 Antibody (5H8) [H00051703-M01] - Detection limit for recombinant GST tagged ACSL5 is approximately 0.1ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/ACSL5-Antibody-5H8-Sandwich-ELISA-H00051703-M01-img0011.jpg "Sandwich ELISA: ACSL5 Antibody (5H8) [H00051703-M01] - Detection limit for recombinant GST tagged ACSL5 is approximately 0.1ng/ml as a capture antibody.")
![Western Blot: ACSL5 Antibody (5H8) [H00051703-M01] - Representative western blotting (n = 3) for U87Empty, U87WT, and U87Mut cell protein extracts. The membranes were blotted with ACSL5 (H00051703-M01). The relative quantification of the bands is shown under the line. Blot was stripped and reprobed with anti-beta actin. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/35574033/) licensed under a CC-BY license.](http://images.novusbio.com/fullsize/h00051703-m01_mouse-monoclonal-acsl5-antibody-5h8-25520231539511.jpg "Western Blot: ACSL5 Antibody (5H8) [H00051703-M01] - Representative western blotting (n = 3) for U87Empty, U87WT, and U87Mut cell protein extracts. The membranes were blotted with ACSL5 (H00051703-M01). The relative quantification of the bands is shown under the line. Blot was stripped and reprobed with anti-beta actin. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/35574033/) licensed under a CC-BY license.")
![Western Blot: ACSL5 Antibody (5H8) [H00051703-M01] - Effects of IGF1R localization over cell metabolism. (A) U87Empty, U87WT, & U87Mut cells were cultured 24 h in serum-free medium or with 50-nM IGF1 stimulation (IGF1). To test the specificity of the response, pre-incubation (1 h) with 0.5 μM OSI906 was also performed (IGF1+ OSI). (A, B) GLUT1 mRNA expression was calculated by rqPCR by the relative quantitation method. (A) Values are presented as fold change compared to control conditions (serum-free). (B) IGF1 stimuli comparison between cell lines. The results are presented as fold change due to IGF1 stimulation over basal conditions (serum-free). Values are expressed as mean ± SD of three independent experiments performed in triplicates (*p < 0.05, **p < 0.005, ***p < 0.001, ****p < 0.0001, ANOVA, Tukey’s post-test). (C) LDH enzyme activity was measured & normalized to DNA content (mg). The results are expressed as mean ± SD of three independent experiments (**p < 0.005, ANOVA, Tukey’s post-test). (D) Representative western blotting (n = 3) for U87Empty, U87WT, & U87Mut cell protein extracts. The membranes were blotted with anti-pPDC (line 1), anti-FAS (line 3), anti-ACSL5 (line 5), & anti-pS6K (line 7). Each blot was stripped & reprobed with anti-beta actin (lines 2, 4, & 6) or antitotal-S6K (line 8). The relative quantification of the bands is shown under each line. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/35574033), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/h00051703-m01_mouse-monoclonal-acsl5-antibody-5h8-310202415482271.jpg "Western Blot: ACSL5 Antibody (5H8) [H00051703-M01] - Effects of IGF1R localization over cell metabolism. (A) U87Empty, U87WT, & U87Mut cells were cultured 24 h in serum-free medium or with 50-nM IGF1 stimulation (IGF1). To test the specificity of the response, pre-incubation (1 h) with 0.5 μM OSI906 was also performed (IGF1+ OSI). (A, B) GLUT1 mRNA expression was calculated by rqPCR by the relative quantitation method. (A) Values are presented as fold change compared to control conditions (serum-free). (B) IGF1 stimuli comparison between cell lines. The results are presented as fold change due to IGF1 stimulation over basal conditions (serum-free). Values are expressed as mean ± SD of three independent experiments performed in triplicates (*p < 0.05, **p < 0.005, ***p < 0.001, ****p < 0.0001, ANOVA, Tukey’s post-test). (C) LDH enzyme activity was measured & normalized to DNA content (mg). The results are expressed as mean ± SD of three independent experiments (**p < 0.005, ANOVA, Tukey’s post-test). (D) Representative western blotting (n = 3) for U87Empty, U87WT, & U87Mut cell protein extracts. The membranes were blotted with anti-pPDC (line 1), anti-FAS (line 3), anti-ACSL5 (line 5), & anti-pS6K (line 7). Each blot was stripped & reprobed with anti-beta actin (lines 2, 4, & 6) or antitotal-S6K (line 8). The relative quantification of the bands is shown under each line. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/35574033), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Immunocytochemistry FATP1/SLC27A1 Antibody (308420) [Unconjugated]](https://images.novusbio.com/images2/FATP1_MAB3304_Immunocytochemistry__Immunofluorescence_19621.jpg)
![Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.](https://images.novusbio.com/images/Mouse-IgG1-Kappa-Light-Chain-Isotype-Control-P3-6-2-8-1-Flow-Cytometry-NBP1-43319-img0002.jpg "Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.")